KEGG   Rattus norvegicus (rat): 25577Help
Entry
25577             CDS       T01003                                 

Gene name
Ywhaq, 14-3-3t
Definition
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta
Orthology
K16197  
14-3-3 protein beta/theta/zeta
Organism
rno  Rattus norvegicus (rat)
Pathway
Cell cycle
Oocyte meiosis
PI3K-Akt signaling pathway
Hippo signaling pathway
Hepatitis B
Epstein-Barr virus infection
Viral carcinogenesis
Class
Environmental Information Processing; Signal transduction; Hippo signaling pathway [PATH:rno04390]
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:rno04151]
Cellular Processes; Cell growth and death; Cell cycle [PATH:rno04110]
Cellular Processes; Cell growth and death; Oocyte meiosis [PATH:rno04114]
Human Diseases; Cancers; Viral carcinogenesis [PATH:rno05203]
Human Diseases; Infectious diseases; Hepatitis B [PATH:rno05161]
Human Diseases; Infectious diseases; Epstein-Barr virus infection [PATH:rno05169]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
6q16
AA seq 245 aa AA seqDB search
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIENSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaccgagctgatccagaaggccaagctggccgagcaggccgagcgctacgac
gacatggccacctgcatgaaagccgtgacggagcagggcgccgagctgtccaacgaggag
cgcaacctgctatctgtggcctacaagaacgtggtcgggggccgcaggtccgcctggagg
gtcatctcgagcattgagcagaagaccgatacctcggacaagaagttgcagctgatcaag
gactatcgggagaaagtggagtctgagctgaggtccatctgcaccacggtcctggaattg
ttggataagtatttaatagccaatgcaactaatccagagagtaaggtcttctatctgaaa
atgaagggagattatttccggtatcttgctgaagtcgcttgtggtgatgatcgaaaacaa
acgatagaaaattcccaaggagcctaccaagaggcatttgatataagcaagaaagagatg
caacctacacatccgatccgcctggggctggctcttaacttttctgtattttactatgag
atccttaataatcccgagcttgcctgcacactggctaaaacggcttttgatgaagccatc
gccgagcttgatacactgaatgaagactcctacaaagacagcaccctcatcatgcagttg
cttagagacaacttaacattatggacatcagacagtgcaggagaagaatgtgatgcagct
gagggggctgagaactaa

DBGET integrated database retrieval system