KEGG   Rattus norvegicus (rat): 25577Help
Entry
25577             CDS       T01003                                 

Gene name
Ywhaq, 14-3-3t
Definition
tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta
Orthology
K16197  
14-3-3 protein beta/theta/zeta
Organism
rno  Rattus norvegicus (rat)
Pathway
Cell cycle
Oocyte meiosis
PI3K-Akt signaling pathway
Hippo signaling pathway
Hepatitis B
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    25577 (Ywhaq)
   04151 PI3K-Akt signaling pathway
    25577 (Ywhaq)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    25577 (Ywhaq)
   04114 Oocyte meiosis
    25577 (Ywhaq)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    25577 (Ywhaq)
  Infectious diseases
   05161 Hepatitis B
    25577 (Ywhaq)
   05169 Epstein-Barr virus infection
    25577 (Ywhaq)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   25577 (Ywhaq)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
6q16
AA seq 245 aa AA seqDB search
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIENSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaccgagctgatccagaaggccaagctggccgagcaggccgagcgctacgac
gacatggccacctgcatgaaagccgtgacggagcagggcgccgagctgtccaacgaggag
cgcaacctgctatctgtggcctacaagaacgtggtcgggggccgcaggtccgcctggagg
gtcatctcgagcattgagcagaagaccgatacctcggacaagaagttgcagctgatcaag
gactatcgggagaaagtggagtctgagctgaggtccatctgcaccacggtcctggaattg
ttggataagtatttaatagccaatgcaactaatccagagagtaaggtcttctatctgaaa
atgaagggagattatttccggtatcttgctgaagtcgcttgtggtgatgatcgaaaacaa
acgatagaaaattcccaaggagcctaccaagaggcatttgatataagcaagaaagagatg
caacctacacatccgatccgcctggggctggctcttaacttttctgtattttactatgag
atccttaataatcccgagcttgcctgcacactggctaaaacggcttttgatgaagccatc
gccgagcttgatacactgaatgaagactcctacaaagacagcaccctcatcatgcagttg
cttagagacaacttaacattatggacatcagacagtgcaggagaagaatgtgatgcagct
gagggggctgagaactaa

DBGET integrated database retrieval system