KEGG   Rattus norvegicus (rat): 25577Help
Entry
25577             CDS       T01003                                 

Gene name
Ywhaq, 14-3-3t
Definition
(RefSeq) tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein, theta
  KO
K16197  14-3-3 protein beta/theta/zeta
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04110  Cell cycle
rno04114  Oocyte meiosis
rno04151  PI3K-Akt signaling pathway
rno04390  Hippo signaling pathway
rno05161  Hepatitis B
rno05169  Epstein-Barr virus infection
rno05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04390 Hippo signaling pathway
    25577 (Ywhaq)
   04151 PI3K-Akt signaling pathway
    25577 (Ywhaq)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    25577 (Ywhaq)
   04114 Oocyte meiosis
    25577 (Ywhaq)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    25577 (Ywhaq)
  Infectious diseases
   05161 Hepatitis B
    25577 (Ywhaq)
   05169 Epstein-Barr virus infection
    25577 (Ywhaq)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    25577 (Ywhaq)
Exosome [BR:rno04147]
 Exosomal proteins
  Proteins found in most exosomes
   25577 (Ywhaq)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 14-3-3 FliM
Motif
Other DBs
NCBI-GeneID: 25577
NCBI-ProteinID: NP_037185
RGD: 3979
Ensembl: ENSRNOG00000051650
UniProt: P68255
Position
6q16
AA seq 245 aa AA seqDB search
MEKTELIQKAKLAEQAERYDDMATCMKAVTEQGAELSNEERNLLSVAYKNVVGGRRSAWR
VISSIEQKTDTSDKKLQLIKDYREKVESELRSICTTVLELLDKYLIANATNPESKVFYLK
MKGDYFRYLAEVACGDDRKQTIENSQGAYQEAFDISKKEMQPTHPIRLGLALNFSVFYYE
ILNNPELACTLAKTAFDEAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDSAGEECDAA
EGAEN
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
atggagaagaccgagctgatccagaaggccaagctggccgagcaggccgagcgctacgac
gacatggccacctgcatgaaagccgtgacggagcagggcgccgagctgtccaacgaggag
cgcaacctgctatctgtggcctacaagaacgtggtcgggggccgcaggtccgcctggagg
gtcatctcgagcattgagcagaagaccgatacctcggacaagaagttgcagctgatcaag
gactatcgggagaaagtggagtctgagctgaggtccatctgcaccacggtcctggaattg
ttggataagtatttaatagccaatgcaactaatccagagagtaaggtcttctatctgaaa
atgaagggagattatttccggtatcttgctgaagtcgcttgtggtgatgatcgaaaacaa
acgatagaaaattcccaaggagcctaccaagaggcatttgatataagcaagaaagagatg
caacctacacatccgatccgcctggggctggctcttaacttttctgtattttactatgag
atccttaataatcccgagcttgcctgcacactggctaaaacggcttttgatgaagccatc
gccgagcttgatacactgaatgaagactcctacaaagacagcaccctcatcatgcagttg
cttagagacaacttaacattatggacatcagacagtgcaggagaagaatgtgatgcagct
gagggggctgagaactaa

DBGET integrated database retrieval system