KEGG   Rattus norvegicus (rat): 25586Help
Entry
25586             CDS       T01003                                 

Gene name
Alpl, Akp2, PHOA
Definition
alkaline phosphatase, liver/bone/kidney (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:rno00790]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
5q36
AA seq 524 aa AA seqDB search
MILPFLVLAIGPCLTNSFVPEKEKDPSYWRQQAQETLKNALKLQKLNTNVAKNIIMFLGD
GMGVSTVTAARILKGQLHHNTGEETRLEMDKFPFVALSKTYNTNAQVPDSAGTATAYLCG
VKANEGTVGVSAATERTRCNTTQGNEVTSILRWAKDAGKSVGIVTTTRVNHATPSAAYAH
SADRDWYSDNEMRPEALSQGCKDIAYQLMHNIKDIDVIMGGGRKYMYPKNRTDVEYELDE
KARGTRLDGLDLISIWKSFKPRHKHSHYVWNRTELLALDPSRVDYLLGLFEPGDMQYELN
RNNLTDPSLSEMVEVALRILTKNPKGFFLLVEGGRIDHGHHEGKAKQALHEAVEMDEAIG
KAGTMTSQKDTLTVVTADHSHVFTFGGYTPRGNSIFGLAPMVSDTDKKPFTAILYGNGPG
YKVVDGERENVSMVDYAHNNYQAQSAVPLRHETHGGEDVAVFAKGPMAHLLHGVHEQNYI
PHVMAYASCIGANLDHCAWASSASSPSPGALLLPLALFPLRTLF
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
atgatcttgccatttttagtactggccatcggaccctgccttaccaactcatttgtgcca
gagaaagagaaagaccccagttactggcgacagcaagcccaagagaccttgaaaaatgcc
ctgaaactccaaaaactcaacaccaacgtggccaagaacatcatcatgttcctgggagat
ggtatgggcgtctccacagtgacagctgcccgcatccttaagggccagctacaccacaac
acgggcgaggagacacggctggagatggacaagttcccctttgtggctctctccaagacg
tacaacaccaacgctcaggtccccgacagcgcgggcactgccactgcctacttgtgtggc
gtgaaggccaacgagggcaccgtgggagtgagcgcggccactgagcgcacgcgatgcaac
accactcaggggaacgaggtcacgtccatcctgcgctgggccaaggatgctgggaagtcc
gtgggcatcgtgaccaccactcgggtgaaccacgccactcccagtgcagcctatgcgcac
tcggccgatcgggactggtactcggacaatgagatgcgcccagaggctctgagccagggc
tgcaaggacatcgcctatcagctaatgcacaacatcaaggacatcgatgtgatcatgggt
ggtggccggaagtacatgtaccccaagaacagaactgatgtggaatatgaactggatgag
aaggccaggggcaccagactggatggcctggacctcatcagcatttggaagagcttcaaa
cctagacacaagcactcccactatgtctggaaccgcactgaactgctggcccttgacccc
tccagggtggactacctcttaggtctctttgagcccggggacatgcagtatgagttgaat
cggaacaacctgactgacccttccctctcggagatggtggaggtggccctccggatcctg
acaaagaatcccaaaggcttcttcttgctagtggaaggaggcaggattgaccacgggcac
catgaaggcaaggccaagcaggcgctgcatgaggccgtggagatggatgaggccatcgga
aaggcgggcaccatgacttcccagaaagacacgttgactgtggttactgctgatcactcc
cacgttttcacgtttggtggctacacccccaggggcaactccatttttggtctggctccc
atggtgagcgacacggacaagaagcccttcacagccatcctgtatggcaacgggcctggt
tacaaggtggtggacggtgaacgggagaacgtctccatggtggattatgctcacaacaac
taccaggcccagtccgctgtccccctgcggcacgagacccacggtggggaagatgtggcg
gtctttgccaagggccctatggctcacctgcttcacggcgtccatgagcagaactacatc
ccccacgtcatggcgtatgcctcctgcattggagccaaccttgaccactgtgcctgggcc
agctctgcgagcagcccctccccaggggccctgctgcttccactggctctgttcccccta
cgcaccctgttctga

DBGET integrated database retrieval system