KEGG   Rattus norvegicus (rat): 25591Help
Entry
25591             CDS       T01003                                 

Gene name
Parp1, ARTD1, Adprt, Parp-1
Definition
(RefSeq) poly (ADP-ribose) polymerase 1 (EC:2.4.2.30)
  KO
K10798  
poly [ADP-ribose] polymerase [EC:2.4.2.30]
Organism
rno  Rattus norvegicus (rat)
Pathway
Base excision repair
NF-kappa B signaling pathway
Apoptosis
Module
BER complex
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    25591 (Parp1)
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    25591 (Parp1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    25591 (Parp1)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.30  NAD+ ADP-ribosyltransferase
     25591 (Parp1)
DNA replication proteins [BR:rno03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    25591 (Parp1)
Chromosome [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Centriole proteins
    25591 (Parp1)
DNA repair and recombination proteins [BR:rno03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Other BER factors
     25591 (Parp1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
13q26
AA seq 1014 aa AA seqDB search
MAEATERLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKV
GHSIRQPDTEVDGFSELRWDDQQKVKKTAEAGGVAGKGQHGGGGKAEKTLGDFAAEYAKS
NRSTCKGCMEKIEKGQMRLSKKMLDPEKPQLGMIDRWYHPTCFVKNRDELGFRPEYSASQ
LKGFSLLSAEDKEALKKQLPAVKSEGKRKCDEVDGIDEVAKKKSKKGKDKESSKLEKALK
AQNELVWNIKDELKKACSTNDLKELLIFNQQQVPSGESAILDRVADGMAFGALLPCKECS
GQLVFKSDAYYCTGDVTAWTKCMVKTQNPSRKEWVTPKEFREISYLKKLKIKKQDRLFPP
ESSAPAPPAPPVSITSAPTAVNSSAPADKPLSNMKILTLGKLSQNKDEAKAMIEKLGGKL
TGSANKASLCISTKKEVEKMSKKMEEVKAANVRVVCEDFLQDVSASAKSLQELLSAHSLS
SWGAEVKVEPGEVVVPKGKSAAPSKKSKGAVKEEGVNKSEKRMKLTLKGGAAVDPDSGLE
HSAHVLEKGGKVFSATLGLVDIVKGTNSYYKLQLLESDKESRYWIFRSWGRVGTVIGSNK
LEQMPSKEDAVEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLAVKPG
TKSKLPKPVQELVGMIFDVESMKKALVEYEIDLQKMPLGKLSRRQIQAAYSILSEVQQAV
SQGSSESQILDLSNRFYTLIPHDFGMKKPPLLNNTDSVQAKVEMLDNLLDIEVAYSLLRG
GSDDSSKDPIDVNYEKLKTDIKVVDRDSEEAEVIRKYVKNTHATTHNAYDLEVIDIFKIE
REGESQRYKPFRQLHNRRLLWHGSRTTNFAGILSQGLRIAPPEAPVTGYMFGKGIYFADM
VSKSANYCHTSQGDPIGLILLGEVALGNMYELKHASHISKLPKGKHSVKGLGKTAPDPSA
SITLDGVEVPLGTGIPSGVNDTCLLYNEYIVYDIAQVNLKYLLKLKFNFKTSLW
NT seq 3045 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggccacggagaggctttaccgagtggagtacgctaagagcgggcgcgcctct
tgcaagaaatgcagcgagagtatccccaaggactcgctccgcatggccatcatggtgcag
tcacccatgttcgatggaaaagtcccacactggtatcacttctcctgcttctggaaggtg
ggccactccatccggcagcctgacacagaggtggacgggttctctgagctgcggtgggat
gaccagcagaaggtcaagaagaccgcagaggctggaggcgtggcaggcaaaggccagcat
ggaggtggcggcaaggcggagaagacgctgggcgactttgcggcagagtatgccaagtcc
aacaggagcacatgcaagggctgcatggagaagatagagaagggtcagatgcgcctgtcc
aagaagatgctggatccagagaagccgcaactgggtatgattgaccgctggtaccatcca
acttgctttgtcaagaaccgggacgagctgggcttccggcctgagtacagtgccagccag
ctcaagggctttagcctcctctctgcagaagacaaagaagctctgaagaagcagctcccg
gcagtcaagagtgaaggaaagagaaaatgtgacgaggtggatggaatagatgaagtagcc
aaaaagaaatctaaaaaaggaaaggacaaggagagtagtaaactggaaaaggcgctcaag
gctcagaacgagctggtctggaatatcaaagatgagctgaagaaagcctgctccaccaac
gacctgaaggagttgctcatcttcaaccagcagcaagtaccatctggagagtccgcaatc
ctggaccgagttgctgatggcatggcgtttggggcccttctgccctgcaaggagtgttca
ggacagctggtttttaagagcgacgcttattactgtactggggatgtcactgcctggacc
aagtgcatggtcaagacacagaatcccagccgaaaggaatgggtaactccaaaggaattc
cgagaaatatcctacctcaagaaattaaagatcaaaaagcaggaccggctgttccctcca
gagagcagcgccccagcaccaccagcacctcccgtctcgatcacctccgcacccacagct
gtgaactcctctgcaccagcagacaaacccctgtctaacatgaagatcctgactcttggt
aagctctcccagaacaaggacgaagcaaaggccatgattgagaaactcggaggcaagctg
acaggatctgccaacaaggcctccttgtgtatcagcactaagaaggaggtggagaagatg
agtaagaagatggaggaagtgaaagcagccaatgttcgagtcgtgtgtgaggacttcctc
caggatgtgtctgcctcagctaagagcctccaagagctgctctcagcccatagcttgtcc
tcgtggggggctgaggtgaaggtagagcctggtgaagtggtggtccccaaggggaagtca
gctgcaccctccaagaagagcaagggtgctgtcaaggaggaaggtgtcaacaagtctgaa
aagaggatgaaactaactctgaagggaggagcagccgttgatcctgactctggtctggaa
cactctgcacatgtcctggagaaaggcgggaaggtgttcagtgccacgcttggcctggtg
gacattgtgaaagggactaactcctattacaaactgcaacttctggagtccgacaaggag
agcaggtattggatcttccggtcctggggccgagtgggcacagttatcggcagtaacaag
cttgagcagatgccgtccaaagaggatgctgttgaacacttcatgaagttatacgaagag
aagactggaaatgcctggcactcgaaaaacttcacaaagtatcccaagaagttctaccct
ctggagattgactatggccaggacgaagaggcagtaaagaagctggcggtgaagcctggc
actaagtcgaagctgccgaagccggtgcaggagctcgtcgggatgatcttcgacgtggag
agcatgaagaaggccttggtggagtacgagattgaccttcagaagatgcccttggggaaa
ctgagcagaaggcagatccaggccgcctactctatcctcagtgaggtccagcaggcagtg
tcccaaggcagcagtgaatctcagatcctggatctctccaatcgcttctacaccctcatc
ccccatgactttggaatgaagaagcccccacttctgaacaacacagacagtgtgcaggcc
aaggtggagatgctggacaacctcctggacatcgaggttgcctatagtcttctcaggggt
gggtctgatgacagcagtaaggaccccatcgatgtcaactatgagaagctcaaaactgac
attaaggtggttgacagagattctgaagaggctgaggtcatcaggaagtatgtgaagaac
actcacgcgaccacgcacaatgcctatgacctggaagtgatagacatctttaagatagag
cgagagggagagagccaacgctacaagcccttcaggcagcttcacaaccggagactgctg
tggcacgggtccaggaccaccaacttcgcaggcatcctgtcacagggtctgcggatagcc
ccacctgaagcacctgtgacaggctacatgtttgggaaaggaatctactttgctgatatg
gtgtccaaaagtgcgaactactgccacacgtctcagggagacccgattggcttaatactg
ttgggagaagttgcccttggaaacatgtacgaactcaagcatgcttctcacatcagcaag
ttacccaagggcaagcacagtgtcaaaggtttgggcaaaaccgcccctgacccttcggcc
agcatcaccctggatggtgtagaggttccgctgggaacagggattccgtctggtgttaat
gacacctgcctgctgtataacgagtacattgtctacgacattgctcaggtgaatctgaag
tacctactgaaactgaagttcaatttcaagacctccttgtggtag

DBGET integrated database retrieval system