KEGG   Rattus norvegicus (rat): 25604Help
Entry
25604             CDS       T01003                                 

Gene name
Pcmt1, PCM
Definition
protein-L-isoaspartate (D-aspartate) O-methyltransferase 1 (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     25604 (Pcmt1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
1p13
AA seq 227 aa AA seqDB search
MAWKSGGASHSELIHNLRKNGIIKTDKVFEVMLATDRSHYAKSNPYMDSPQSIGFQATIS
APHMHAYALELLFDQLHEGAKALDVGSGSGILTACFARMVGHSGKVIGIDHIKELVDDSI
TNVKKDDPMLLSSGRVRLVVGDGRMGFAEEAPYDAIHVGAAAPVVPQALIDQLKPGGRLI
LPVGPAGGNQMLEQYDKLQDGSVKMKPLMGVIYVPLTDKEKQWSRWK
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcctggaaatccggcggcgccagccactcggagctaatccacaacctccgcaagaat
ggaatcatcaagacagataaagtatttgaggtgatgctggctacagaccgctcccactat
gcaaaatctaacccttacatggattctccacagtcaataggtttccaggcaacaatcagc
gctcctcacatgcatgcatatgcactagagctcctgtttgaccagctgcacgaaggcgct
aaagcccttgacgtagggtctggaagtggaatcctcaccgcgtgttttgcacggatggtt
ggacacagtgggaaagtcattggaattgatcacattaaagaactagtggatgactcaata
actaatgtcaaaaaggatgaccccatgctcctgtcctctgggcgagtacggctggttgtg
ggcgatggaagaatggggtttgctgaagaagccccttacgatgccattcacgtcggagct
gcagccccagttgtgccccaggcattaatagaccagttaaagcctggtggaagattgata
ttgccagtcggtcctgcaggaggaaaccaaatgttggagcagtatgacaagctacaagat
ggcagtgtcaaaatgaagcctctgatgggggtgatatacgtgcctttaacagataaagaa
aagcagtggtccaggtggaagtga

DBGET integrated database retrieval system