KEGG   Rattus norvegicus (rat): 25612Help
Entry
25612             CDS       T01003                                 

Gene name
Asns
Definition
asparagine synthetase (glutamine-hydrolyzing) (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
rno  Rattus norvegicus (rat)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    25612 (Asns)
Enzymes [BR:rno01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     25612 (Asns)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C44
   25612 (Asns)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
4q13-q21
AA seq 561 aa AA seqDB search
MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQ
PIRVRKYPYLWLCYNGEIYNHKALQQRFEFEYQTNVDGEIILHLYDKGGIEKTICMLDGV
FAFILLDTANKKVFLGRDTYGVRPLFKALTEDGFLAVCSEAKGLVSLKHSTTPFLKVEPF
LPGHYEVLDLKPNGKVASVEMVKYHHCTDEPLHAIYDSVEKLFPGFEIETVKNNLRILFN
NAIKKRLMTDRRIGCLLSGGLDSSLVAASLLKQLKEAQVPYALQTFAIGMEDSPDLLAAR
KVANYIGSEHHEVLFNSEEGIQSLDEVIFSLETYDITTVRASVGMYLISKYIRKNTDSVV
IFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLKELYLFDVLRADRTTAAHGLELRVPF
LDHRFSSYYLSLPPEMRIPKDGIEKHLLRETFEDSNLLPKEILWRPKEAFSDGITSVKNS
WFKILQDFVEHQVDDAMMSEASQKFPFNTPQTKEGYYYRQIFEHHYPGRADWLTHYWMPK
WINATDPSARTLTHYKSTAKA
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggcatctgggccctcttcggcagcgatgactgcctttccgtgcagtgtctgagt
gcgatgaagattgcgcacaggggcccagatgcattccgttttgagaacgtcaatggatac
accaactgctgttttggcttccaccggctggcggtggttgaccccctgtttggaatgcag
ccaataagagtgaggaaatatccttatctgtggctgtgttacaacggtgaaatctacaac
cacaaggcgctacaacaacgtttcgaatttgagtatcagaccaatgtggacggtgagata
attctccatctctatgacaaaggcggcatcgagaaaaccatctgtatgttggatggggtg
tttgcatttatcttactggacactgccaataagaaagtattcctgggcagagatacctat
ggtgtcaggcctttgtttaaagccttgacagaagatggatttctggctgtgtgttcagaa
gccaaaggccttgtctccttgaaacactccaccacccccttcctaaaagtggagcccttt
cttcctggacactatgaagttttggatttaaaaccaaatggcaaagtcgcgtctgtggaa
atggtcaaataccatcactgtacggatgaaccactgcatgccatctatgacagtgtggag
aaactcttcccaggctttgagatagagaccgtgaaaaacaatctgcgtatcctttttaac
aacgctatcaagaaacgcttgatgactgaccggaggattggctgccttttatcaggaggc
ctggactccagcttggttgctgcctccctgctgaagcaactcaaggaggcccaagtgccc
tatgctctccagacatttgctatcggcatggaagacagccctgatctactggctgccaga
aaggtggcaaattatattggaagtgagcatcatgaagtcctttttaactctgaagaaggc
attcagtccctggacgaagtcatattttccttggaaacttatgatattacgacagttcga
gcatctgtaggtatgtatttaatttccaagtatattcggaagaacacagacagcgtggtg
atcttctccggagaggggtcagatgagcttacacagggctatatatatttccacaaggcg
ccttctcctgagaaggcggaggaggagagtgagaggctcctgaaggaactctacctgttt
gatgtcctccgtgccgaccgcactactgctgctcacggtctcgaactgagagtcccgttt
ctggatcatcggttttcttcctattacctgtctctgccaccagaaatgagaattccaaaa
gatggcatagaaaaacatctcctgagagagacttttgaggactccaacctgctacccaaa
gagattctctggcgacccaaggaagccttcagtgatgggatcacctcagtcaagaactcc
tggttcaagattttacaggacttcgttgaacatcaggttgatgatgcgatgatgtctgag
gcctcccagaaatttcccttcaatactccccaaactaaagaaggctattactaccgtcag
atctttgaacaccattaccccggccgggctgattggctgacccattattggatgcccaag
tggatcaatgccaccgacccttctgcccgcactctgacccattacaagtcaactgccaaa
gcttag

DBGET integrated database retrieval system