KEGG   Rattus norvegicus (rat): 25623Help
Entry
25623             CDS       T01003                                 

Gene name
Gys2, GLYSN
Definition
(RefSeq) glycogen synthase 2 (EC:2.4.1.11)
  KO
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
Starch and sucrose metabolism
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Glucagon signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    25623 (Gys2)
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    25623 (Gys2)
   04152 AMPK signaling pathway
    25623 (Gys2)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    25623 (Gys2)
   04922 Glucagon signaling pathway
    25623 (Gys2)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    25623 (Gys2)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     25623 (Gys2)
Glycosyltransferases [BR:rno01003]
 Polysaccharide
  Storage polysaccharide
   25623 (Gys2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
4q44
AA seq 704 aa AA seqDB search
MLRGRSLSVTSLGGLPAWEAERLPVEDLLLFEVSWEVTNKVGGICTVIQSKAKTTANEWG
ENYFLIGPYFEHNVKTQVEPCEPANDAVRKAVDAMNKHGCQVHFGRWLIEGSPYVVLFDI
SSSAWNLDRWKGDFWEACGVGIPHDDREANDMLIFGSLTAWFLKEVTDHADGKHVIAQFH
EWQAGTGLILSRARKLPIATIFTTHATLLGRYLCAANIDFYNQLDKFNIDKEAGERQIYH
RYCMERASVHCAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVKKFSAVHEFQNLHATY
KARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLNFLLRMHKSNV
TVVVFFIMPAKTNNFNVETLKGQAVRKQLWDTVHCMKEKFGKKLYDGLLRGEIPDMNSIL
DRDDLTIMKRAIFSTQRHSLPPVTTHNMIDDSTDPILSTIRRIGLFNNRTDRVKVILHPE
FLSSTSPLLPMDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVTTNLSGFGCFMQE
HVADPTAYGIYIVDRRFRSPDDSCNQLTQFLYGFCKQSRRQRIIQRNRTERLSDLLDWRY
LGRYYQHARHLTLSRAFPDKFHLEPTSPPTTDGFKYPRPSSVPPSPSGSQTSSPQSSDVE
NEGDEDERYDEEEEAERDRLNIKSPFSLNHIPKGKKKLHGEYKN
NT seq 2115 nt NT seq  +upstreamnt  +downstreamnt
atgctcaggggccgctccttgtctgtgacgtcccttggtgggctccctgcatgggaagct
gaaagactccccgtggaagacttattgctttttgaagtttcctgggaagtgaccaacaaa
gttgggggcatctgtactgtgatccagagcaaagccaaaaccacagccaatgaatgggga
gagaattacttcctgataggtccgtattttgagcataatgtgaagactcaagtagagcca
tgcgagcccgccaacgatgccgtcagaaaagctgtggatgccatgaacaaacatggctgc
caggtgcattttggaagatggctgatagaagggagtccgtatgtggtgctttttgacatc
agctcctcagcgtggaacctggacaggtggaagggagacttctgggaagcatgtggcgtt
ggcatccctcacgacgaccgagaagccaatgacatgctcatatttgggtctttaactgcc
tggttcttaaaggaggtgacggaccatgcagacggtaaacacgtcattgcccaattccat
gaatggcaggctggaactgggctgatcctttctcgtgccaggaaactccccatcgccaca
atatttacaacccatgccacactgctggggcggtatctctgtgcagcaaatattgacttc
tacaaccagcttgataagttcaacatagacaaagaggccggggagaggcagatttatcac
cgctactgcatggagcgggcttccgtgcactgtgcgcacgtgtttaccacagtgtcagaa
atcacagccatcgaggcggagcacatgctgaagaggaagcctgatgtggtgactccaaac
ggcttgaacgttaagaagttttctgcggtgcacgagtttcaaaatctccatgccacatac
aaggccaggatacaggattttgttcgaggtcatttctatggccacctggacttcgatctt
gaaaagacgttatttcttttcattgctgggaggtatgagttctccaacaagggagcagac
atcttcctagaatccttatccaggctcaatttcctcctaaggatgcataagagtaacgtc
actgtggtagtgtttttcatcatgcctgccaagacaaacaatttcaacgtggaaaccctg
aagggccaggcggtgcggaaacagctgtgggacactgtgcactgtatgaaggaaaagttt
ggaaagaaactctacgatgggttattaagaggagaaatacccgacatgaatagtattttg
gatcgagatgacttaacaattatgaaaagagccattttttcaactcagagacactctttg
cctcctgtgaccactcacaatatgatcgacgattccacggatcccatcctcagcaccatt
cgacgaattggacttttcaacaatcgcacagacagagtcaaggtgattttacacccagaa
ttcctgtcctccaccagccccctactaccaatggattatgaagagtttgtccgaggctgt
caccttggggtatttccatcatactatgagccctggggttacacgccagccgaatgcaca
gtgatgggcatccccagtgtgactacgaacctctctggtttcgggtgtttcatgcaggag
catgtggctgaccctaccgcgtacggtatttatatcgtcgacagacgcttccgctctcca
gatgattcttgcaaccagctgactcagtttctctatgggttctgtaaacagtcccgccgc
caaagaatcatccagaggaaccgcaccgagaggctttcagatcttctggactggagatac
ctgggcagatattaccagcatgccagacatctgacactgagcagggcttttccagacaaa
ttccacctggagcccacatccccaccaacgacggatggctttaagtatcccaggccctcc
tcagtaccaccttccccatcaggatcccagacttcaagtcctcagagcagcgatgtggaa
aacgaaggggatgaggatgagagatatgatgaggaagaggaggctgagagggaccggcta
aacatcaagtcaccattttccctgaaccacatcccaaaggggaagaaaaagcttcatgga
gaatataagaactga

DBGET integrated database retrieval system