KEGG   Rattus norvegicus (rat): 25634Help
Entry
25634             CDS       T01003                                 

Gene name
G6pc, G6Pase
Definition
glucose-6-phosphatase, catalytic subunit (EC:3.1.3.9)
Orthology
K01084  
glucose-6-phosphatase [EC:3.1.3.9]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
FoxO signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
Adipocytokine signaling pathway
Carbohydrate digestion and absorption
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    25634 (G6pc)
   00052 Galactose metabolism
    25634 (G6pc)
   00500 Starch and sucrose metabolism
    25634 (G6pc)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    25634 (G6pc)
   04151 PI3K-Akt signaling pathway
    25634 (G6pc)
   04152 AMPK signaling pathway
    25634 (G6pc)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    25634 (G6pc)
   04920 Adipocytokine signaling pathway
    25634 (G6pc)
  Digestive system
   04973 Carbohydrate digestion and absorption
    25634 (G6pc)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.9  glucose-6-phosphatase
     25634 (G6pc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q32.1
AA seq 357 aa AA seqDB search
MEERMNVLHDFGIQSTRYLQVNYEDSQDWFVLVSVIADLRNAFYVLFPIWFHIQETVGIN
LLWVAVVGDWFNLVFKWILFGQRPYWWVLDTDYYSNSSVPLIKQFPVTCETGPGSPSGHA
MGTAGVYYVMVTSTLAIFRGKKKSTYGFRCLNVVLWLGYWAVQLNVCLSRIYLAAHFPHQ
VVAGVLSGIAVAETFSHIRGIYNASLQRYCLITFFLFGFALGFYLLLKGLGVDLLWTLEK
AKRWCERPEWVHLDTTPFASLFKNLGTLLGLGLALNSSMYRKSCKGELRKSLPFRLACIV
ASLGLLHLFDSLKPPSQIESIFYILSFCKSATVPFASVSLIPYCLARLLGQTHKKSL
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atggaggaaagaatgaacgtgctccacgactttgggatccagtcgactcgctacctccaa
gtgaattacgaagactcccaggactggtttgtcttggtgtctgtgatcgctgacctcagg
aacgccttctatgtcctctttcccatctggttccacattcaagagactgtgggcatcaat
ctcctctgggtggcagtggttggagactggttcaacctcgtctttaagtggattcttttt
ggacagcgcccgtattggtgggtcctggacactgactattacagcaacagctccgtgcct
ctgataaaacagttccccgtcacctgtgagactggaccagggagtccctcgggccatgcc
atgggcacagcaggtgtatactacgttatggttacttctactctcgctatctttcgtgga
aagaaaaagtcaacgtatggattccggtgcttgaatgtcgtcttgtggttgggatactgg
gctgtgcagctgaacgtctgtctgtcccggatctaccttgcggctcactttccccatcag
gtggtggctggagtcttgtcaggcattgctgtggctgaaactttcagccacatccggggc
atctacaatgccagcctccagaggtactgtctcatcaccttcttcctgtttggtttcgca
cttggattttacctgctgctaaaggggctaggggtggacctcctgtggactttggagaag
gccaagagatggtgtgagcgccccgagtgggtccaccttgacactacaccctttgccagc
ctcttcaaaaacctggggaccctcttggggttggggctggccctcaactccagcatgtac
cgcaagagctgcaaaggagaactgcgcaagtcgctcccattccgtttggcctgcatcgtg
gcctccttgggcctgctgcatctctttgactcgctgaagcccccgtcccagattgagtcg
atcttctacatcttgtctttctgcaagagtgcgaccgtcccctttgcatctgtcagtctt
atcccctactgcctagcccggctcctgggacagacacacaagaagtctttgtaa

DBGET integrated database retrieval system