KEGG   Rattus norvegicus (rat): 25636Help
Entry
25636             CDS       T01003                                 

Gene name
Prkaca, Cs-PKA, PKCA1
Definition
protein kinase, cAMP-dependent, catalytic, alpha (EC:2.7.11.11)
Orthology
K04345  
protein kinase A [EC:2.7.11.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
MAPK signaling pathway
Ras signaling pathway
Calcium signaling pathway
Chemokine signaling pathway
Oocyte meiosis
Apoptosis
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Wnt signaling pathway
Hedgehog signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term potentiation
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
GABAergic synapse
Dopaminergic synapse
Olfactory transduction
Taste transduction
Inflammatory mediator regulation of TRP channels
Insulin signaling pathway
Insulin secretion
GnRH signaling pathway
Ovarian steroidogenesis
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Thyroid hormone synthesis
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Endocrine and other factor-regulated calcium reabsorption
Vasopressin-regulated water reabsorption
Salivary secretion
Gastric acid secretion
Bile secretion
Parkinson's disease
Prion diseases
Cocaine addiction
Amphetamine addiction
Morphine addiction
Alcoholism
Amoebiasis
HTLV-I infection
Epstein-Barr virus infection
Viral carcinogenesis
Proteoglycans in cancer
Dilated cardiomyopathy
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    25636 (Prkaca)
   04010 MAPK signaling pathway
    25636 (Prkaca)
   04310 Wnt signaling pathway
    25636 (Prkaca)
   04340 Hedgehog signaling pathway
    25636 (Prkaca)
   04020 Calcium signaling pathway
    25636 (Prkaca)
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    25636 (Prkaca)
   04210 Apoptosis
    25636 (Prkaca)
  Cell communication
   04540 Gap junction
    25636 (Prkaca)
 Organismal Systems
  Immune system
   04611 Platelet activation
    25636 (Prkaca)
   04062 Chemokine signaling pathway
    25636 (Prkaca)
  Endocrine system
   04911 Insulin secretion
    25636 (Prkaca)
   04910 Insulin signaling pathway
    25636 (Prkaca)
   04912 GnRH signaling pathway
    25636 (Prkaca)
   04913 Ovarian Steroidogenesis
    25636 (Prkaca)
   04915 Estrogen signaling pathway
    25636 (Prkaca)
   04914 Progesterone-mediated oocyte maturation
    25636 (Prkaca)
   04921 Oxytocin signaling pathway
    25636 (Prkaca)
   04918 Thyroid hormone synthesis
    25636 (Prkaca)
   04919 Thyroid hormone signaling pathway
    25636 (Prkaca)
   04916 Melanogenesis
    25636 (Prkaca)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    25636 (Prkaca)
   04270 Vascular smooth muscle contraction
    25636 (Prkaca)
  Digestive system
   04970 Salivary secretion
    25636 (Prkaca)
   04971 Gastric acid secretion
    25636 (Prkaca)
   04976 Bile secretion
    25636 (Prkaca)
  Excretory system
   04962 Vasopressin-regulated water reabsorption
    25636 (Prkaca)
   04961 Endocrine and other factor-regulated calcium reabsorption
    25636 (Prkaca)
  Nervous system
   04724 Glutamatergic synapse
    25636 (Prkaca)
   04727 GABAergic synapse
    25636 (Prkaca)
   04725 Cholinergic synapse
    25636 (Prkaca)
   04728 Dopaminergic synapse
    25636 (Prkaca)
   04726 Serotonergic synapse
    25636 (Prkaca)
   04720 Long-term potentiation
    25636 (Prkaca)
   04723 Retrograde endocannabinoid signaling
    25636 (Prkaca)
  Sensory system
   04740 Olfactory transduction
    25636 (Prkaca)
   04742 Taste transduction
    25636 (Prkaca)
   04750 Inflammatory mediator regulation of TRP channels
    25636 (Prkaca)
  Environmental adaptation
   04713 Circadian entrainment
    25636 (Prkaca)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    25636 (Prkaca)
   05203 Viral carcinogenesis
    25636 (Prkaca)
  Neurodegenerative diseases
   05012 Parkinson's disease
    25636 (Prkaca)
   05020 Prion diseases
    25636 (Prkaca)
  Substance dependence
   05030 Cocaine addiction
    25636 (Prkaca)
   05031 Amphetamine addiction
    25636 (Prkaca)
   05032 Morphine addiction
    25636 (Prkaca)
   05034 Alcoholism
    25636 (Prkaca)
  Cardiovascular diseases
   05414 Dilated cardiomyopathy (DCM)
    25636 (Prkaca)
  Infectious diseases
   05166 HTLV-I infection
    25636 (Prkaca)
   05169 Epstein-Barr virus infection
    25636 (Prkaca)
   05146 Amoebiasis
    25636 (Prkaca)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     25636 (Prkaca)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: AGC group
  PKA family
   25636 (Prkaca)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
19q11
AA seq 351 aa AA seqDB search
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWETPSQNTAQLDHFDRIKTLGTGSFGRVML
VKHKESGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFTEF
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgggcaacgccgccgccgccaagaagggcagcgagcaggagagcgtgaaagagttccta
gccaaagccaaggaagatttcctgaaaaaatgggagaccccttctcagaatacagcccag
ttggatcattttgatagaatcaagacccttggcaccggctcctttgggcgagtgatgctc
gtgaagcacaaggaaagtgggaaccactatgccatgaagatcttggacaagcagaaggtg
gtgaagctgaagcagatcgagcacactctgaatgagaagcgcatcctgcaggctgtcaac
ttcccgttcctggtcaaacttgaattctccttcaaggacaactcaaacttgtacatggtc
atggagtacgtgcctggtggggagatgttctcccacttacggcggattgggaggttcagt
gagccccacgcccgtttctacgcggcgcagatcgtcttgacttttgagtatctgcactcc
ctggacctcatctaccgggacctgaagcccgagaaccttctcatcgaccagcagggctat
attcaggtgacagacttcggttttgccaagcgtgtgaaaggccgaacttggaccttgtgt
gggacccccgagtacttggcccccgagattatcctgagcaaaggctacaacaaagctgtg
gactggtgggctctcggggtcctcatctacgagatggctgctggttacccgcccttcttc
gctgaccagcctatccagatctatgagaaaatcgtctctgggaaggtgcggttcccatcc
cacttcagctctgacttgaaggacctgcttcggaaccttctgcaggtggatctcaccaag
cgctttgggaatctcaagaacggggtcaatgacatcaagaaccacaagtggtttgccaca
actgactggatcgccatctatcagagaaaggtggaagctcccttcataccaaagtttaaa
ggccctggggacacgagtaactttgacgactatgaggaggaagagatccgggtctccatc
aatgagaaatgtggcaaggagtttactgagttttag

  All links  
No link information was found.   
DBGET integrated database retrieval system