KEGG   Rattus norvegicus (rat): 25642Help
Entry
25642             CDS       T01003                                 

Gene name
Cyp3a23/3a1, CYP, CYP3A23, Cyp3a1, Cyp3a3, RL33, cDEX
Definition
cytochrome P450, family 3, subfamily a, polypeptide 23/polypeptide 1 (EC:1.14.14.1)
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Class
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:rno00140]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:rno00591]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:rno00830]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:rno05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
12p11
AA seq 502 aa AA seqDB search
MDLLSALTLETWVLLAVVLVLLYGFGTRTHGLFKKQGIPGPKPLPFFGTVLNYYMGLWKF
DVECHKKYGKIWGLFDGQMPLFAITDTEMIKNVLVKECFSVFTNRRDFGPVGIMGKAISV
SKDEEWKRYRALLSPTFTSGRLKEMFPVIEQYGDILVKYLRQEKGKPVPVKEVFGAYSMD
VITSTSFGVNVDSLNNPKDPFVEKAKKLLRIDFFDPLFLSVVLFPFLTPVYEMLNICMFP
KDSIEFFKKFVYRMKETRLDSVQKHRVDFLQLMMNAHNDSKDKESHTALSDMEITAQSII
FIFAGYEPTSSTLSFVLHSLATHPDTQKKLQEEIDRALPNKAPPTYDTVMEMEYLDMVLN
ETLRLYPIGNRLERVCKKDVEINGVFMPKGSVVMIPSYALHRDPQHWPEPEEFRPERFSK
ENKGSIDPYVYLPFGNGPRNCIGMRFALMNMKLALTKVLQNFSFQPCKETQIPLKLSRQG
LLQPTKPIILKVVPRDEIITGS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atggacctgctttcagctctcacactggaaacctgggtcctcctggcagtcgtcctggtg
ctcctctacggatttgggacccgcacacatggacttttcaagaaacaggggattcctggg
cccaaacctctgcctttttttggcactgtgctgaattactatatgggtttatggaaattc
gatgtggagtgccataaaaagtatggaaaaatatgggggttgtttgatggtcaaatgcct
ctgtttgccatcacggacacagaaatgatcaagaatgtgctagtgaaggaatgcttttct
gtcttcacaaaccggcgggattttggcccagtggggattatggggaaagccatctctgta
tctaaggatgaggagtggaagagatatagagccttgctgtcacccacgttcaccagtgga
agactcaaggagatgttccctgtcatcgaacagtatggagacattttggtaaaatacttg
aggcaagagaaaggcaaacctgtccctgtgaaagaagtgtttggtgcctacagcatggat
gtgatcaccagcacatcatttggagtgaatgttgattccctcaacaacccgaaggatcct
tttgtggagaaagccaagaagctcttaagaattgatttttttgatccgttgttcttgtca
gtagtactctttccattcctcacgccagtatatgagatgttaaacatctgcatgttccca
aaagattcaatagaatttttcaaaaaatttgtgtacagaatgaaggaaacccgcctggat
tctgtgcagaagcatcgagtggattttcttcagctgatgatgaatgctcataatgattct
aaagacaaagaatctcatacagccctatccgatatggagatcacagcccagtcaatcatt
tttatttttgctggatatgaacccaccagcagcacactttcctttgtcctgcattccctg
gccactcacccagatacacagaagaaactgcaggaggagatcgacagggctctgcccaat
aaggcacctcccacctatgatactgtgatggaaatggaatacctggatatggtgttgaat
gaaaccctcagattgtatccaattggtaatagacttgagagagtctgtaaaaaagatgtt
gaaatcaatggtgtgtttatgcccaaagggtcagtggtcatgattccatcttatgctctt
caccgtgatccacagcactggccagagcctgaggaatttcgcccagaaaggttcagcaag
gagaacaagggcagcattgatccttatgtatatctgccctttggaaatggacccaggaac
tgcattggcatgaggtttgctctcatgaatatgaaactcgctctcactaaagttctgcaa
aacttctccttccagccttgtaaggaaacacagatacctctgaaattaagcagacaagga
cttcttcaaccaacaaaacccattattctaaaggttgtgccacgggatgaaatcataact
ggatcatga

DBGET integrated database retrieval system