KEGG   Rattus norvegicus (rat): 25683Help
Entry
25683             CDS       T01003                                 

Gene name
Col12a1
Definition
collagen, type XII, alpha 1
Orthology
K08132  
collagen, type XII, alpha
Organism
rno  Rattus norvegicus (rat)
Pathway
Protein digestion and absorption
Class
Organismal Systems; Digestive system; Protein digestion and absorption [PATH:rno04974]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Position
8q31
AA seq 3064 aa AA seqDB search
MQTGLPRALAALGVALLLSSIEAEVDPPSDLNFKIIDENTVHMSWERPADPIVGYRITVD
STTDGPTKEFTLAASTTETLLSNLIPETQYVVTITSYDEVEESVPVIGQLTIETGDPAKP
GEKKPGKTEIQKCSVSAWTDLVFLVDGSWSVGRNNFKYILDFIVALVSAFDIGEEKTRVG
VVQYSSDTRTEFNLNQYYRREDLLAAIKKIPYKGGNTMTGDAIDYLVKNTFTESAGSRAG
FPKVAIIITDGKSQDEVEIPARELRNIGVEVFSLGIKAADAKELKQIASTPSLNHVFNVA
NFDAIVDIQNEIISQVCSGVDEQLGELVSGEEVIEPPSNLVVTDLSSKFIRLRWDPSPSA
VTGYKILLTPMAAGSRHHALSVGPQTTTLNVRDLSADTEYQISVFAMKGLTSSEPVSVME
KTQPMKVQVECSRGVDIKADIVFLVDGSYSIGIANFVKVRAFLEVLAKSFEISPNRVQIS
LVQYSRDPHTEFTLKEFNRVEDIIKAINNFPYRGGSTNTGKAMTYVREKIFVPNKGSRSN
VPKVMILITDGKSSDAFRDPAIKLRNSDVEIFAVGVKDAVRSELEAIASPPAETHVFTVE
DFDAFQRISFELTQSICLRIEQELAAIKKKAYVPPKDLRFTQVTANSFKAEWSPAGDNVF
SYHITYKDTTGDDEVTVVEPASSTSVVLSNLKPETLYLVNVTAEYEDGFSVPVVGEETTA
EVKGAPRNLKVTDETTDSFKITWSQAPGRVLRYRIMYRPVSGGESKEVSTPANQRRKTLE
NLTPDTKYEISVIAEYSSGPGSPLTGSAATEEVRGNPRDLRVSDATTSTLKLTWSGAPGK
VKQYLVTYTPAAGGETQEVTVRGDTTTTVLRNLKEGTQYDLSVTALYASGAGEALSGKGT
TLEERGSPQNLVTKDITDTSIGAYWTSAPGMVRGYRVSWKSLYDDIEAGEKTLPGDAIHT
MIENLQPETKYKISVFATYSSGEGEPVTGDATTELSQDSKILKVDEETEHTMRVTWKAAP
GKVINYRVVYRPQGGGRQMVAKVPPTVTSTVLKRLQPQTTYDITVLPMYKTGEGKLRQGS
GTTASRFKSPRNLKTSDPTMSSFRVTWEPAPGEVKGYKVTFHPTGDDRRLGELVLGPYDN
TVVLEELRAGTTYRVNVFGMFDGGESLPLVGQEMTTLSDTTVTPFLSSGMECLTRAEADI
VLLVDGSWSIGRANFRTVRSFISRIVEVFEIGPKRVQIALAQYSGDPRTEWHLNAHRDKK
SLLQAVANLPYKGGNTLTGMALNFIRQQSFKTQAGMRPRARKIGVLITDGKSQDDVEAPS
KKLKDEGVELFAIGIKNADEVELKMIATDPDDIHAYNVADFESLSKIVDDLTINLCNSVK
GPGDLEAPSNLVISERTHRSFRVSWTPPSDSVDRYKVEYYPVSGGKRQEFYVSRLETSTV
LKDLKPETEYVVNVYSVVEDEYSEPLKGTEKTLPVPVVSLNIYDIGPTTMHVQWQPVGGA
TGYTVSYQPTRSPEGTKPKEMRVGPTVNDVQLTGLLPNTEYEVTVQAVLHDLTSEPAKAR
EATLPLPRPQDVKIRDVTHSTMNVIWEPVLGKVRKYTVRYKTPEEEFKEVEVDRSRTSTT
LKDLSSQTQYTVSVSAVYDEGTSPPATAHETTRPVPAPTNLQFTEVTPESFRGTWDHGAS
DVSLYRITWAPVGNPDKLETILNGDENTLLFENLDPNTLYDVSITAIYPDESESEDLSGS
ERTLRLIPLTTQAPKSGPRNLQVYNATSNSLTVKWDPASGRVQKYRITYQPSTGEGNEQT
TTVGGRQNSVVLQKLKPDSPYTITVSSQYPDGEGGRMTGRGKTKPLNTVRNLRVYDPSTS
TLSVRWDHAEGNPRQYKLFYAPAGGPEELVPIPGNTNYAILRNLQPDTPYTVTVVPVYAE
GDGGRTSDTGRTLVRGLARNVQVYNPTPNSLDVRWDSAPGPVQQYRIVYSPVAGTRPSES
IVVPGNTRTVHLERLIPDTPYSVNIVALYSDGEGNPSPGQGRTLPRSGPRNLRVFGETTN
SLSVAWDHADGPVQQYRIIYSPIVGDPIDEYTTVPGRRNNVILQPLQPDTPYKITVIAIY
EDGDGGHLTGNGRTVGLLPPQNMHISDEWYTRFRVSWDPSPSPVLGYKIVYKPVGSNEPM
EAFVGEVTSYTLHNLNPSTTYDVSVYAQYDSGLSVPLTDQGTTLYLNVTDLKTYQVGWDT
FCVKWSPHRAATSYRLKLSPADGTRGQEITVRGSETSHCFTGLSPEAEYGVTVFVQTPNL
EGPGVPIKEQTTVKPTEAPTEPPTPSPPPTIPPARDVCKGAKADIVFLTDASWSIGDDNF
NKVVKFIFNTVGAFDEISPAGIQVSFVQYSDEVKSEFKLNTYNDKALALGALQNIRYRGG
NTRTGKALTFIKEKVLTWESGMRKNVPKVLVVVTDGRSQDEVKKAAFIIQQSGFSVFVVG
VADVDYNELANIASKPSERHVFIVDDFESFEKIEDNLITFVCETATSSCPLVYLDGYTSP
GFKMLEAYNLTEKNFASVQGVSLESGSFPSYSAYRLQKNAFINQPTAELHPNGLPPSYTI
ILLFRLLPETPSDPFAIWQITDRDYRPQVGVIADPSSKTLSFFNKDTRGEVQTVTFDADE
AKTLFYGSFHKVHIVVTSKSVKIYIDCYEIVEKDIKEAGNITTDGYEILGKLLKGERKSA
TFQIQSFDIICSPVWTSRDRCCDIPSRRDEAKCPALPNACTCTQDSVGPPGPPGPAGGPG
AKGPRGERGINGAVGPPGPRGDTGPPGPQGPPGPQGPNGLSIPGEQGRQGMKGDAGEPGL
PGRTGTPGLPGPPGPMGPPGDRGFTGKDGAMGPRGPPGPPGTPGSPGVTGPSGKPGKPGD
HGRPGQSGLKGEKGDRGDIASQNMMRAVARQVCEQLISGQMSRFNQMLNQIPNDYHSNRN
QPGPPGPPGPPGSAGARGEPGPGGRPGFPGTPGMQGPQGERGLPGEKGERGIGSQGPRGP
PGPPGPQGESRTGPPGSTGSRGPPGPPGRPGNSGIRGPPGPPGYCDSSQCASIPYNGQGY
PGSG
NT seq 9195 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccgggcttccccgagcgctggccgccctgggcgtggccctactcctgtcttct
attgaggcagaagttgacccaccttccgacttgaattttaaaattatagatgaaaatact
gtccatatgtcatgggagagaccagctgatccaattgtgggttacagaataacagtggac
tctacaacagatgggcctactaaagaatttacccttgcagctagtaccactgaaacccta
ttatcaaaccttattcctgaaacacagtacgtggtcaccatcacttcctacgatgaagta
gaagaaagtgtgccggttataggccaactaacaattgaaacaggtgatccagcaaaacca
ggggagaagaaacctggaaaaacagagatacaaaagtgctctgtcagcgcctggaccgac
ttagtgtttcttgtggatggctcctggagtgtgggaagaaataatttcaagtacatttta
gacttcattgttgctcttgtgtctgcctttgacattggggaggagaagacaagggtggga
gttgttcagtacagctcagacaccaggactgaatttaacttaaatcagtattaccgaaga
gaagacctgcttgctgcaattaaaaaaataccatacaaaggtggcaacacaatgacaggg
gatgccattgactacttagtcaaaaacactttcactgagtctgctggctcaagagctggc
tttcctaaagtggcgatcattatcacggatggcaagtctcaggatgaagtagaaattcca
gcacgggaacttcggaatattggagttgaggttttctctctgggcattaaagctgcagat
gcaaaagaactcaaacaaattgcatccacaccttccctgaaccacgtgttcaatgtggcc
aattttgatgcaatcgtggacattcagaatgagataatctcccaggtgtgttcaggagtt
gatgagcaacttggtgagctggtcagtggagaagaagtcatcgagcctccttcaaatctg
gtagtcacagatctctcatcaaaattcattaggctgagatgggatccgtctcccagcgct
gtgactggctataagatcctcctcacaccaatggctgccgggagccgccatcacgctttg
agtgtggggccccagacgaccacgctcaatgttcgtgacctttcagctgacacagaatac
cagatcagcgtttttgccatgaaggggctaacatccagtgagcctgtttcagtcatggag
aagacacagccaatgaaagttcaagtagaatgttcacgtggtgtggatataaaagccgac
atcgtgtttttggttgatggttcctacagcatcggcattgcaaactttgttaaagttaga
gcctttttggaagttcttgcaaaaagttttgagatttctccaaacagggtgcagataagc
cttgtccagtacagcagagaccctcacactgaatttacattgaaggagtttaacagagtt
gaagacataatcaaagcaataaataacttcccgtacaggggaggatccacaaacacaggc
aaagcaatgacttacgtcagagagaaaatatttgtgcctaacaaaggctccagaagcaac
gtaccaaaggtgatgattctcatcacagatgggaagtcgtcagatgctttcagggaccct
gctataaaactcaggaactcggacgtggagatcttcgcagttggtgtaaaggatgctgtg
cgctcagaactggaagccattgcctctcctcccgctgagacacatgtgttcacagtggag
gacttcgatgcctttcagaggatatcgtttgaactcacacagtctatctgtcttagaatt
gagcaagagttggcagctataaagaagaaagcttatgtgccgccaaaggatctgagattt
actcaggtaactgctaatagtttcaaagctgaatggtctcctgctggagacaacgtcttc
tcgtatcacatcacgtacaaggacactactggtgacgatgaggtcacagtggtggagcca
gcctccagcaccagtgttgttctcagcaacctgaaaccagagaccctgtacttggtgaat
gtgacggcagagtatgaggatggcttcagcgtccctgtagttggggaggagaccacggct
gaagtaaaaggagcaccacgaaacctgaaggtgactgatgagacgacggacagttttaaa
attacctggtctcaagctccagggagagtcttaaggtaccgaattatgtacagaccagtt
tctggtggagaaagtaaagaagtcagtactccagccaaccagaggaggaaaacactggag
aacctgacgccagacacaaagtatgaaatatctgtaattgctgaatattcatccggacct
ggctctccactgacaggaagtgcagccactgaagaagttagagggaatccaagagactta
agagtttctgatgccacgacatcaacgctgaagttgacttggagtggggccccaggaaaa
gtgaagcagtatcttgtcacatacaccccagcagcaggaggtgaaactcaggaggtcact
gtgagaggggatacaaccaccacggtgttgaggaacttgaaggaagggacacagtacgac
ttatctgtgacagcactgtatgcgtctggggctggtgaggccctttctggaaaagggaca
acacttgaagaacgtggttcacctcaaaatctagttaccaaagacatcacagacacatca
atcggggcctattggacatctgctccagggatggttcgagggtacagggtctcatggaag
tcgctttatgacgatattgaggccggagagaaaactcttcctggagatgcaattcacact
atgattgagaatctgcagccagagaccaagtacaaaatttcagtttttgcaacttacagc
agtggagaaggagagccggtgactggagatgccacaactgaattatctcaagactccaaa
atcttaaaagtggatgaagaaacagaacacacaatgagagttacctggaaagcagcgccg
gggaaagtcatcaactaccgcgttgtgtatcgccctcaagggggtgggagacagatggtt
gctaaggttccacccacggtcacttcaacagtgctaaagaggcttcaaccccagaccaca
tatgacatcacagttctcccaatgtataagacaggagaaggaaagcttagacaaggatca
ggaacaacagcttctcgatttaaatcgccgagaaacctcaaaacttctgacccaacaatg
tcaagtttccgagtgacttgggagcctgcccctggggaagtgaaaggttacaaagtcacc
tttcaccctacaggtgacgacagaagacttggggagttggtccttggaccatatgacaac
acagttgtcttggaggagcttagggcaggcactacatatagagtcaatgtttttgggatg
ttcgatggaggagaaagtttaccacttgttgggcaggaaatgacaaccctttctgacaca
actgtgacaccatttctatcttccgggatggaatgtctcaccagagctgaagcagacatt
gtgttgctggtggatgggtcatggagcattggccgcgcaaattttagaactgtgcgaagc
ttcatctctcgtatcgtggaagtctttgaaatcggccccaagagagtacaaattgctctc
gctcagtacagtggagaccccagaacagagtggcacctaaacgctcatagagacaagaag
agtttgttacaggctgtggcgaacttgccgtataagggaggaaacaccctcacaggcatg
gctttgaatttcattcgccaacagagcttcaagactcaagctggcatgcggcctcgtgct
cgcaaaattggagttctcattaccgatggaaaatcacaggatgatgtggaggctccatcc
aagaagctcaaggatgaaggtgtagagctgtttgctatcggtattaagaatgctgacgaa
gttgagttaaagatgattgccactgatccagatgacattcacgcatacaatgtggcagat
tttgagtcattgtccaagattgtggatgacctcaccatcaacttgtgtaacagtgtcaag
ggccctggtgacttggaagcaccatctaacttagttatttcagagagaactcatcgttct
tttagagtgagctggacacccccttctgacagtgtggacagatacaaggtggaatactat
cctgtctctggagggaaacgccaggagttttacgtgagtcgactagaaactagcacagtg
ttgaaggatctgaagcccgagactgagtatgtggtgaacgtgtattctgtggttgaagat
gagtacagtgagcctctgaagggcacagagaaaaccttgccagtccctgtagttagcctg
aatatttatgatattggccccaccactatgcatgtgcaatggcagcctgtgggaggagct
actggctacactgtatcataccaacctacaagatctccagaaggaacaaagcccaaagag
atgcgtgtggggcccacagtgaatgatgtgcagctgaccggcctccttcctaacacagag
tatgaggtcaccgtccaggcagtcttgcatgacctcactagtgaacctgccaaagctcgg
gaagccacattgcccttacccagaccccaggatgtgaaaatcagagatgtgacccacagt
accatgaatgtcatctgggagcctgtgcttggaaaagttcgcaaatacactgttagatat
aaaactccagaagaggagttcaaagaggtggaggtggacagatcaaggaccagcactacc
ctcaaagacctctcctctcaaacccagtacacagtgagcgtttccgcagtgtatgatgag
ggcacatctcccccggcgactgctcatgagacaacccggcctgttccagccccaaccaac
ctacagtttactgaagtaactccggagagttttaggggaacctgggatcacggtgcttca
gatgtgtctctctacagaataacctgggcacctgtcggaaacccagataagctggagacc
atcttaaatggagatgaaaataccttgctgtttgaaaatctggaccccaacactctgtat
gatgtctccatcactgccatttatcccgatgagtctgaaagcgaggacctgagtggcagc
gagcgcacattgcgtctgatacccttaacgacacaagctccaaaaagtggtccacggaac
ctgcaggtgtacaatgccacatctaacagtttgactgttaagtgggaccctgctagtggt
cgtgtgcaaaaatacagaatcacctatcagccttcaactggagaaggcaatgagcaaacg
accacagtaggaggacggcagaacagcgtggtcctgcagaaactgaagcccgacagtccg
tacaccatcaccgtgtcatcccagtatcctgatggtgaaggcggccggatgactggaagg
ggcaaaactaaacctctgaataccgtgaggaatttgagagtgtatgacccatctaccagc
actttgagtgttcgctgggaccatgcagaaggcaatcctcgccagtacaaactcttctat
gccccagccggtggtccagaagaactggtaccaatccctgggaataccaactatgccatt
cttaggaacctgcagccagatactccatacactgtcacagtggttcctgtctatgcagaa
ggtgacggcgggcgcacatcagatactggaaggacactggtgagaggactggcgagaaat
gtccaagtgtataaccctacgcccaacagcctcgatgtccgctgggactctgccccaggg
ccagtgcagcagtaccgcattgtgtactccccagtggctgggacaagaccctcagaatct
attgtggtgccagggaatacccgcacggtgcatctggagaggttgattcctgacacaccc
tactctgtgaacatcgtggctctctactcagatggagaggggaatcccagccctggccag
ggccgaacactgccacggagtggaccaagaaatctacgagtctttggggagacgaccaac
agcctctctgtagcctgggaccatgctgacgggccagttcagcaatacaggatcatctat
tctcctatcgtgggcgatccaattgatgaatataccacagttccaggcaggagaaacaat
gtaatactgcagcccctgcaacctgacactccatataaaattactgtcattgccatttat
gaggatggagatggtggccatctaactggaaacgggaggactgtgggtctgcttccgcct
cagaacatgcacatctctgacgaatggtacacaaggttccgagtgtcctgggacccttca
ccctcaccagtccttggatataaaattgtgtacaagccagtgggttccaatgagcccatg
gaagcctttgttggagaagtgacgtcatacactttacacaacctcaatcccagcactacc
tatgatgtcagtgtttatgcacagtatgactctggactcagcgttcccctcacagatcaa
ggcaccacgttgtacttaaatgtgacagatctgaaaacttaccaggttggatgggacacc
ttctgtgtcaaatggtcacctcaccgggcagcgacctcttacaggctaaagctgagtcct
gccgatggaaccaggggacaagaaataacagtgagaggatcagagaccagtcactgcttc
actggcctctccccggaggctgagtatggcgttactgtttttgtgcagacaccaaatctc
gaggggccgggtgtccccatcaaagaacagacgactgtgaaaccaacagaggctcccaca
gaaccgcccacgccttcacctcctcccactatcccacctgcccgtgatgtatgcaaaggg
gccaaggcagatattgtgttcctgacggatgcctcttggagtattggagatgacaatttt
aacaaagttgtaaaatttatttttaatactgtgggggcctttgatgaaatcagccctgct
gggattcaggtttcttttgtgcagtacagtgatgaggtcaagtctgaattcaagctgaac
acatacaacgataaggctctagcccttggagccctccagaacattcggtacagaggagga
aacacaagaacaggcaaggccctcacgtttatcaaggagaaggtcttgacctgggaaagt
ggcatgaggaagaatgtcccgaaggtgctagttgtggtcacagatggccggtcacaggat
gaggtgaagaaggcagcctttatcatccagcagtcagggttcagtgtattcgttgttggt
gtggctgatgtggactacaatgagctcgccaacattgccagcaagcccagtgagaggcac
gtgttcattgtggacgactttgaatcttttgagaagatcgaggacaatcttatcacattt
gtttgtgaaactgccacttcaagttgtcctctcgtctatctggatggctacacatcacca
ggctttaagatgcttgaagcttacaacctgacagaaaagaactttgcttctgtccaagga
gtctctttggaatcagggtctttccccagctattcagcctacaggcttcagaagaatgcc
tttatcaatcagcccacagcagaactccatccgaatggactccccccttcatatacgatt
atattattgtttagacttctcccagaaactcctagtgacccctttgcaatttggcaaatt
acagacagagactacagaccacaagttggagtgattgcagatccttctagcaagacactg
tctttctttaataaggatacaagaggcgaggtacagactgttacatttgatgcagatgaa
gcgaagaccttgttttatggaagctttcataaggtccatattgtagtgacctcaaagagt
gttaagatttatattgactgctatgaaattgtagaaaaagacatcaaagaagctggaaat
ataacaactgatggctatgaaattcttggaaaacttcttaaaggagagaggaaatcagcc
acattccaaatccagagctttgacattatctgcagcccagtgtggaccagtagagacaga
tgctgtgatattccctctcggagagatgaagcaaaatgccccgcccttccgaatgcttgc
acatgcacacaggacagcgttggccctccaggtcctccaggccctgcgggaggacctggt
gccaaaggtcccagaggtgaaagaggcatcaatggggcagttgggcccccaggtcctcgt
ggagatactgggcctccaggacctcagggtcctccaggccctcagggacccaatggactc
tccattccaggagaacagggtcgccagggaatgaaaggtgatgcaggagagccagggctt
ccaggccggacaggaaccccaggattacctggcccgccaggaccaatggggccaccagga
gacagaggtttcactggaaaagatggtgcaatgggaccgagaggcccacctgggccaccg
ggaaccccaggctctccaggagtcacagggccaagtgggaaaccgggaaaacctggagat
catggccgacctggtcaatctgggttaaaaggagaaaaaggtgataggggagacattgct
tcccagaacatgatgcgagctgttgcaagacaagtgtgtgaacaactgatcagtggccag
atgagcagattcaaccagatgctgaatcagattccaaacgattaccactcaaatcgaaac
cagcctggcccaccaggacctccagggccccctggcagtgctggagccagaggagaacca
gggccggggggacgaccaggattccctggcacgcctgggatgcaaggacctcagggcgaa
cgaggtttgcctggagagaaaggtgaaaggggtattgggtcgcaaggaccccgaggacct
ccagggcccccaggtccacaaggtgaatccagaacaggtccaccagggtctacaggttca
agaggccctcctggtccccctggtcgtccaggaaactcaggtatccgaggacccccaggt
cctcctggatattgtgattcatcccagtgtgccagcattccatacaacgggcaaggctat
ccaggttccggctaa

DBGET integrated database retrieval system