KEGG   Rattus norvegicus (rat): 25692Help
Entry
25692             CDS       T01003                                 

Gene name
Plat, PATISS, tPA
Definition
(RefSeq) plasminogen activator, tissue type
  KO
K01343  
tissue plasminogen activator [EC:3.4.21.68]
Organism
rno  Rattus norvegicus (rat)
Pathway
Apelin signaling pathway
Complement and coagulation cascades
Transcriptional misregulation in cancer
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    25692 (Plat)
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    25692 (Plat)
 Human Diseases
  Cancers
   05202 Transcriptional misregulation in cancers
    25692 (Plat)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    25692 (Plat)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.68  t-plasminogen activator
     25692 (Plat)
Peptidases [BR:rno01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   25692 (Plat)
Glycosaminoglycan binding proteins [BR:rno00536]
 Heparan sulfate/Haparin
  Coagulation and fibrinolysis (General comment) Coagulation, inflammation, complement control
   25692 (Plat)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
UniProt: 
Position
16q12.5
AA seq 559 aa AA seqDB search
MKGELLCVLLLCGVAFTLPDQGIHRRFRRGARSYRATCRDEQTQTTYQQHQSWLRPMLRG
NRVEYCRCNSGLAQCHSVPVRSCSEPRCFNGGTCQQALYFSDFVCQCPDGFVGKRCDIDT
RATCFEGQGITYRGTWSTAENGAECINWNSSALSQKPYSARRPNAIKLGLGNHNYCRNPD
RDVKPWCYVFKAGKYTTEFCSTPACPKGPTEDCYVGKGVTYRGTHSFTTSKASCLPWNSM
ILIGKTYTAWRANSQALGLGRHNYCRNPDGDAKPWCHVMKDRKLTWEYCDMSPCSTCGLR
QYKQPQFRIKGGLFTDITSHPWQAAIFVKNKRSPGERFLCGGVLISSCWVLSAAHCFVER
FPPHHLKVVLGRTYRVVPGEEEQTFEIEKYIVHKEFDDDTYDNDIALLQLRSDSSQCAQE
SSSVGTACLPDPDVQLPDWTECELSGYGKHEASSPFFSDRLKEAHVRLYPSSRCTSQHLF
NKTITSNMLCAGDTRTGGNQDVHDACQGDSGGPLVCMIDKRMTLLGIISWGLGCGQKDVP
GIYTKVTNYLNWIQDNMKQ
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atgaagggagagctgttgtgcgtcctgctgctttgtggagtggcgttcacgttgcctgac
cagggaatacacaggaggttcagaagaggagctcggtcctacagagcgacctgcagagat
gaacagactcagacaacttaccaacagcatcagtcatggctacgtcccatgctcagaggc
aatcgggtggaatactgccggtgcaacagcggcctggcacagtgccactcggtgcccgtc
cgaagttgcagtgaaccgagatgcttcaatgggggtacgtgtcagcaggccctgtatttc
tctgacttcgtctgccagtgccctgacggatttgttgggaaacgctgtgatatagatacc
agagcaacctgcttcgagggccagggcatcacctacagaggcacatggagcacagcagaa
aatggggctgaatgcatcaactggaatagcagtgccctgtcccagaagccctacagtgca
aggaggccaaatgccatcaagctgggccttgggaatcacaattactgcagaaacccagac
cgagacgtgaagccctggtgctatgtctttaaggcagggaagtataccacggagttctgc
agcacgccggcttgccctaagggaccaactgaggactgctatgttggaaaaggtgtgact
taccgtggcacccacagctttaccacatccaaggcctcctgcctcccatggaattccatg
atcctgataggcaagacttacacagcgtggagggccaactcccaggcacttggcctgggc
agacacaattattgccggaacccagatggggatgccaaaccttggtgccacgtgatgaag
gaccgaaagctgacatgggaatattgcgacatgtccccatgctccacctgcggcctgagg
caatacaaacagcctcagtttcgaattaaaggaggactcttcacagacatcacctcacac
ccttggcaggccgccatctttgtcaagaacaagaggtctccaggagagagattcctgtgt
ggaggggtgctgatcagttcctgctgggtgctatctgccgcccactgctttgtagagagg
tttccaccccatcatcttaaagtggtcttgggcagaacatacagagtggtccctggagag
gaggagcagacattcgagatcgaaaagtacatagtccataaggaatttgatgacgacact
tatgacaatgacatcgcattactgcagctgaggtcagattccagtcagtgtgcccaggag
agcagttctgtcggcactgcctgcctccctgaccccgacgtacagctccctgactggaca
gagtgtgagctttctggctacggcaagcatgaggcatcctctcctttcttctctgaccgg
ctgaaggaggctcacgtcagactgtatccgtccagccgctgtacctcacagcatctgttt
aacaaaaccatcacgagcaacatgctgtgtgcaggagacacccgaactgggggcaaccaa
gacgtccatgacgcgtgccagggtgactcaggaggccctctggtgtgcatgatcgataag
cggatgactttactgggcatcatcagctggggcctcggctgtgggcagaaggacgtgcca
gggatatacacaaaggtcactaattacctgaactggatccaagacaacatgaagcaatga

DBGET integrated database retrieval system