KEGG   Rattus norvegicus (rat): 25699Help
Entry
25699             CDS       T01003                                 

Gene name
Dbh, DOPBHY
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase) (EC:1.14.17.1)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Class
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:rno00350]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
3p12
AA seq 621 aa AA seqDB search
MQPHLSHQPCWSLPSPSVREAASMYGTAVAIFLVILVAALQGSEPPESPFPYHIPLDPEG
TLELSWNVSYDQEIIHFQLQVQGPRAGVLFGMSDRGEMENADLVMLWTDGDRTYFADAWS
DQKGQIHLDTHQDYQLLQAQRVSNSLSLLFKRPFVTCDPKDYVIEDDTVHLVYGILEEPF
QSLEAINTSGLHTGLQQVQLLKPEVSTPAMPADVQTMDIRAPDVLIPSTETTYWCYITEL
PLHFPRHHIIMYEAIVTEGNEALVHHMEVFQCTNESEAFPMFNGPCDSKMKPDRLNYCRH
VLAAWALGAKAFYYPEEAGVPLGSSGSSRFLRLEVHYHNPRNIQGRRDSSGIRLHYTASL
RPNEAGIMELGLVYTPLMAIPPQETTFVLTGYCTDRCTQMALPKSGIRIFASQLHTHLTG
RKVITVLARDGQQREVVNRDNHYSPHFQEIRMLKNAVTVHQGDVLITSCTYNTENRTMAT
VGGFGILEEMCVNYVHYYPKTELELCKSAVDDGFLQKYFHIVNRFGNEEVCTCPQASVPQ
QFASVPWNSFNRDMLKALYNYAPISVHCNKTSAVRFPGNWNLQPLPKITSAVEEPDPRCP
IRQTRGPAGPFVVITTEADTE
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgcagcctcacctcagccaccagccttgctggagcctccccagccccagcgtccgtgag
gcggcttccatgtatggcactgctgtggccatcttcctggtcatcctggtggctgcactg
cagggctcggagcctccggagagccccttcccttaccacatccccctggaccctgaaggg
actttagagctctcgtggaacgtcagctatgaccaggagatcatccacttccagctccag
gtgcaagggccgagggctggggtcctgttcggaatgtcggatcgaggtgagatggagaac
gcagacctcgtcatgctctggactgacggggacaggacctactttgcggacgcctggagt
gaccagaaagggcagatccatctggatacccatcaggactaccagctgctccaggcacag
agggtgtcaaacagcctatccctgctcttcaagaggccctttgtcacctgcgaccccaag
gattatgtcattgaggatgacactgtccatctagtgtatgggatcctggaggagccattc
cagtccctggaggccatcaacacctcaggcctacatacgggactacagcaggtgcagctt
ctgaagcctgaggtctccactccagccatgcctgcggatgtacaaaccatggatatccgg
gctcctgacgtcctcatccccagcactgagaccacatactggtgctatatcactgagcta
cccctacacttcccccgacaccacatcatcatgtatgaggccattgtcacggagggcaat
gaggccctggtgcaccacatggaggtcttccaatgtacaaatgagtctgaggccttcccc
atgttcaacggaccctgcgactccaagatgaaacctgacagactcaactactgtcgccac
gtgctggcggcatgggccctgggcgccaaggcattttactacccagaagaagccggtgtc
cctttggggagctcaggatcctcccggtttctccgactggaagttcattaccacaatcca
cggaatatacaaggccggcgcgactcctctggcatccgtctacactacacagctagtctc
cgacccaatgaggcaggcatcatggagcttggactggtgtacacgcccttgatggccatc
ccccctcaggagaccacctttgttttgactggctactgcacagacaggtgcacccagatg
gcactgccgaaatctggaatccgcatctttgcctcacagctccacacgcacctgaccggc
aggaaggtgattactgtgctcgccagggatggccaacagagggaagtggtgaacagagac
aaccactacagcccccactttcaggagatcagaatgctgaagaatgctgtgactgtccac
cagggggatgtcctcatcacttcgtgcacatacaacacagaaaacaggacaatggccaca
gtgggggggtttggaatcttggaggagatgtgcgtcaactacgtccactactaccccaaa
acagagctggagctctgcaagagtgccgtggatgatggcttcctgcagaaatacttccac
atagtaaaccggttcggcaatgaggaggtctgcacctgccctcaggcctctgtcccccag
cagttcgcctctgtgccctggaactctttcaatcgtgatatgctcaaggctttgtataac
tatgcccctatctctgtgcactgtaacaagacctctgccgtccgcttcccgggtaactgg
aacctgcagcctctgcctaagatcacttccgcagtggaagaacccgacccacgctgcccc
atccgacagactcggggacccgccggccccttcgttgtcatcaccacggaggcagacact
gagtaa

DBGET integrated database retrieval system