KEGG   Rattus norvegicus (rat): 25699Help
Entry
25699             CDS       T01003                                 

Gene name
Dbh, DOPBHY
Definition
dopamine beta-hydroxylase (dopamine beta-monooxygenase) (EC:1.14.17.1)
Orthology
K00503  
dopamine beta-monooxygenase [EC:1.14.17.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Tyrosine metabolism
Metabolic pathways
Module
Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    25699 (Dbh)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.17  With reduced ascorbate as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.17.1  dopamine beta-monooxygenase
     25699 (Dbh)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
3p12
AA seq 621 aa AA seqDB search
MQPHLSHQPCWSLPSPSVREAASMYGTAVAIFLVILVAALQGSEPPESPFPYHIPLDPEG
TLELSWNVSYDQEIIHFQLQVQGPRAGVLFGMSDRGEMENADLVMLWTDGDRTYFADAWS
DQKGQIHLDTHQDYQLLQAQRVSNSLSLLFKRPFVTCDPKDYVIEDDTVHLVYGILEEPF
QSLEAINTSGLHTGLQQVQLLKPEVSTPAMPADVQTMDIRAPDVLIPSTETTYWCYITEL
PLHFPRHHIIMYEAIVTEGNEALVHHMEVFQCTNESEAFPMFNGPCDSKMKPDRLNYCRH
VLAAWALGAKAFYYPEEAGVPLGSSGSSRFLRLEVHYHNPRNIQGRRDSSGIRLHYTASL
RPNEAGIMELGLVYTPLMAIPPQETTFVLTGYCTDRCTQMALPKSGIRIFASQLHTHLTG
RKVITVLARDGQQREVVNRDNHYSPHFQEIRMLKNAVTVHQGDVLITSCTYNTENRTMAT
VGGFGILEEMCVNYVHYYPKTELELCKSAVDDGFLQKYFHIVNRFGNEEVCTCPQASVPQ
QFASVPWNSFNRDMLKALYNYAPISVHCNKTSAVRFPGNWNLQPLPKITSAVEEPDPRCP
IRQTRGPAGPFVVITTEADTE
NT seq 1866 nt NT seq  +upstreamnt  +downstreamnt
atgcagcctcacctcagccaccagccttgctggagcctccccagccccagcgtccgtgag
gcggcttccatgtatggcactgctgtggccatcttcctggtcatcctggtggctgcactg
cagggctcggagcctccggagagccccttcccttaccacatccccctggaccctgaaggg
actttagagctctcgtggaacgtcagctatgaccaggagatcatccacttccagctccag
gtgcaagggccgagggctggggtcctgttcggaatgtcggatcgaggtgagatggagaac
gcagacctcgtcatgctctggactgacggggacaggacctactttgcggacgcctggagt
gaccagaaagggcagatccatctggatacccatcaggactaccagctgctccaggcacag
agggtgtcaaacagcctatccctgctcttcaagaggccctttgtcacctgcgaccccaag
gattatgtcattgaggatgacactgtccatctagtgtatgggatcctggaggagccattc
cagtccctggaggccatcaacacctcaggcctacatacgggactacagcaggtgcagctt
ctgaagcctgaggtctccactccagccatgcctgcggatgtacaaaccatggatatccgg
gctcctgacgtcctcatccccagcactgagaccacatactggtgctatatcactgagcta
cccctacacttcccccgacaccacatcatcatgtatgaggccattgtcacggagggcaat
gaggccctggtgcaccacatggaggtcttccaatgtacaaatgagtctgaggccttcccc
atgttcaacggaccctgcgactccaagatgaaacctgacagactcaactactgtcgccac
gtgctggcggcatgggccctgggcgccaaggcattttactacccagaagaagccggtgtc
cctttggggagctcaggatcctcccggtttctccgactggaagttcattaccacaatcca
cggaatatacaaggccggcgcgactcctctggcatccgtctacactacacagctagtctc
cgacccaatgaggcaggcatcatggagcttggactggtgtacacgcccttgatggccatc
ccccctcaggagaccacctttgttttgactggctactgcacagacaggtgcacccagatg
gcactgccgaaatctggaatccgcatctttgcctcacagctccacacgcacctgaccggc
aggaaggtgattactgtgctcgccagggatggccaacagagggaagtggtgaacagagac
aaccactacagcccccactttcaggagatcagaatgctgaagaatgctgtgactgtccac
cagggggatgtcctcatcacttcgtgcacatacaacacagaaaacaggacaatggccaca
gtgggggggtttggaatcttggaggagatgtgcgtcaactacgtccactactaccccaaa
acagagctggagctctgcaagagtgccgtggatgatggcttcctgcagaaatacttccac
atagtaaaccggttcggcaatgaggaggtctgcacctgccctcaggcctctgtcccccag
cagttcgcctctgtgccctggaactctttcaatcgtgatatgctcaaggctttgtataac
tatgcccctatctctgtgcactgtaacaagacctctgccgtccgcttcccgggtaactgg
aacctgcagcctctgcctaagatcacttccgcagtggaagaacccgacccacgctgcccc
atccgacagactcggggacccgccggccccttcgttgtcatcaccacggaggcagacact
gagtaa

DBGET integrated database retrieval system