KEGG   Rattus norvegicus (rat): 25706Help
Entry
25706             CDS       T01003                                 

Gene name
Cckbr, Cck2r, Cholrec
Definition
(RefSeq) cholecystokinin B receptor
  KO
K04195  
cholecystokinin B receptor
Organism
rno  Rattus norvegicus (rat)
Pathway
Calcium signaling pathway
Neuroactive ligand-receptor interaction
Gastric acid secretion
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    25706 (Cckbr)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    25706 (Cckbr)
 Organismal Systems
  Digestive system
   04971 Gastric acid secretion
    25706 (Cckbr)
G protein-coupled receptors [BR:rno04030]
 Class A. Rhodopsin family
  Gut peptide
   Cholecystokinin
    25706 (Cckbr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q33
AA seq 452 aa AA seqDB search
MELLKLNRSVQGPGPGSGSSLCRPGVSLLNSSSAGNLSCDPPRIRGTGTRELEMAIRITL
YAVIFLMSVGGNVLIIVVLGLSRRLRTVTNAFLLSLAVSDLLLAVACMPFTLLPNLMGTF
IFGTVICKAISYLMGVSVSVSTLNLVAIALERYSAICRPLQARVWQTRSHAARVILATWL
LSGLLMVPYPVYTMVQPVGPRVLQCMHRWPSARVQQTWSVLLLLLLFFIPGVVIAVAYGL
ISRELYLGLHFDGENDSETQSRARNQGGLPGGAAPGPVHQNGGCRPVTSVAGEDSDGCCV
QLPRSRLEMTTLTTPTPGPVPGPRPNQAKLLAKKRVVRMLLVIVLLFFLCWLPVYSVNTW
RAFDGPGAQRALSGAPISFIHLLSYVSACVNPLVYCFMHRRFRQACLDTCARCCPRPPRA
RPQPLPDEDPPTPSIASLSRLSYTTISTLGPG
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atggagctgctcaagctgaaccgcagcgtgcagggaccaggacccgggtcggggtcttct
ttgtgccgcccgggtgtctcccttctcaacagcagtagtgccgggaacctcagctgtgac
ccccctcgtatccgcggaaccgggaccagagaattggagatggcgattagaatcaccctt
tatgcagtgatctttctgatgagtgttggcggaaacgtgctcatcatcgtggtcctggga
ctgagccgacgcctaagaacggtcaccaacgccttcctgctctccctggcagtcagcgac
ctcctgctggccgtggcttgcatgcccttcacactcctgcccaacctcatgggcacattc
atcttcggcacagtcatctgcaaggccatttcctacctcatgggggtatcagtgagtgta
tccactctaaatctcgtggccatagccctggagcgatacagcgccatctgccgaccactg
caagcacgagtatggcaaacacgctcccacgcagctcgggtgatcttagccacgtggctg
ctgtctggactgcttatggtaccctaccctgtgtacaccatggtacagccagtgggacct
cgagtgctgcagtgcatgcatcgctggcccagtgcacgtgtccaacaaacctggtccgtg
ctactgctactgcttttgttcttcatcccgggtgtggttattgcggtggcctatggactc
atctcccgcgaactctacctaggactccactttgatggtgaaaatgacagcgagacccaa
agccgggcccgaaaccaagggggcctgccgggtggggcagcaccagggcctgtccaccag
aacgggggctgccggcctgtaaccagcgtagctggggaagacagtgatggctgctgtgtg
caacttccgcgttcccgactggagatgacaacgctaaccacacccactcctgggccagtc
cctggccctcggcccaaccaggccaagctgctggctaagaagcgggtggtgcgaatgctg
ctagtgattgttttgcttttcttcctgtgttggctgccagtgtacagcgtcaacacgtgg
cgcgccttcgatggcccaggcgcacaacgagcactctcaggggcccctatctctttcatc
cacttgctgagctacgtctctgcttgtgtcaaccccctggtctactgtttcatgcaccgc
cgcttccgccaggcctgcctggacacatgtgcccgctgttgcccacgccctccacgagct
cgcccacagcctcttccagatgaggatcctcctaccccctccatcgcttcgctgtccagg
ctaagctataccaccatcagcacactggggcctggctga

DBGET integrated database retrieval system