KEGG   Rattus norvegicus (rat): 25734Help
Entry
25734             CDS       T01003                                 

Gene name
Hck, Hctk, p56Hck, p59Hck
Definition
(RefSeq) hemopoietic cell kinase (EC:2.7.10.2)
  KO
K08893  
hemopoietic cell kinase [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
Chemokine signaling pathway
Fc gamma R-mediated phagocytosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    25734 (Hck)
   04062 Chemokine signaling pathway
    25734 (Hck)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     25734 (Hck)
Protein kinases [BR:rno01001]
 Tyrosine protein kinases
  Src family
   25734 (Hck)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    25734 (Hck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
3q41
AA seq 524 aa AA seqDB search
MGGRSSCEDPGCPRGEGRVPRMGCVKSRFLREGSKASKIEPNANQKGPVYVPDPTSPKKL
GPNSINSLPPGVVEGSEDTIVVALYDYEAIHREDLSFQKGDQMVVLEESGEWWKARSLAT
KKEGYIPSNYVARVNSLETEEWFFKGISRKDAERHLLAPGNMLGSFMIRDSETTKGSYSL
SVRDFDPQHGDTVKHYKIRTLDSGGFYISPRSTFSSLQELVVHYKKGKDGLCQKLSVPCV
SPKPQKPWEKDAWEIPRESLQMEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAF
LAEANLMKTLQHDKLVKLHAVVSQEPIFIVTEFMAKGSLLDFLKSEEGSKQPLPKLIDFS
AQISEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARIIEDNEYTAREGAKFPIK
WTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALEHGYRMPRPDNC
PEELYSIMIRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
ctggggggtcgttcgagctgcgaggatccgggctgcccgcgaggcgaagggcgggtgccc
aggatgggatgtgtgaagtccaggttcctccgagaaggaagcaaggcctcaaaaatagag
ccaaatgccaaccagaaaggccctgtgtatgtgccggatcccacgtcccctaagaagctg
ggaccgaacagcatcaacagcctgcccccgggggtcgtggagggctctgaggacaccatt
gtggtcgcactgtacgactatgaggccattcaccgtgaagacctcagcttccagaaggga
gaccagatggtggttctggaggagtctggggagtggtggaaggcccgttccctggctacc
aagaaagaaggctatatcccaagcaattatgtagctcgagttaactctttggagactgag
gagtggttcttcaagggtatcagccggaaggatgcagagcgccacctgctggctcccggg
aacatgctgggctccttcatgatccgggacagtgagaccaccaaagggagctactcactt
tctgttcgagactttgacccccagcacggagacacggtgaagcattataaaatccggaca
ctggacagtggaggcttctacatctctccgaggagcaccttcagcagcctgcaggaactt
gtcgtccactacaagaaggggaaggatgggctctgccagaagctgtcagtgccctgtgtg
tctcccaaaccccagaagccatgggagaaagatgcctgggagattcctcgagaatccctc
cagatggagaagaaactgggagccgggcagtttggagaagtgtggatggccacctacaac
aagcacaccaaagtggcggtgaagacaatgaagccagggagcatgtctgtggaggccttc
ctggcagaggccaacctgatgaagacgttacagcatgataaactggtgaagctgcacgcc
gtggtctctcaggagcccatctttattgtcaccgagttcatggccaaaggaagcctgctg
gactttctcaagagtgaagaaggcagcaagcagccactgccaaaactcattgacttctca
gcccagatttcagagggcatggctttcattgagcagaggaactacatccaccgagacctc
cgggctgccaacatcttggtttctgcatcactggtgtgtaagatcgctgactttggactg
gcacggatcatcgaggacaatgagtacacagctcgggaaggagccaagttccccatcaag
tggacagctcctgaagccatcaactttggctccttcaccatcaagtcagatgtctggtcc
tttggtatcctgctgatggaaatcgtcacctacggccggatcccttacccaggtatgtca
aacccagaggtgattcgagcactagagcatgggtaccgtatgcctcgaccagataactgc
ccagaggagctctacagtatcatgatccgctgctggaagaaccgtccagaggaacggccc
actttcgaatacatccagagcgtgctggatgacttctacacggccactgagagccagtat
cagcagcaaccttga

DBGET integrated database retrieval system