KEGG   Rattus norvegicus (rat): 25734Help
Entry
25734             CDS       T01003                                 

Gene name
Hck, Hctk, p56Hck, p59Hck
Definition
(RefSeq) HCK proto-oncogene, Src family tyrosine kinase
  KO
K08893  hemopoietic cell kinase [EC:2.7.10.2]
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04062  Chemokine signaling pathway
rno04666  Fc gamma R-mediated phagocytosis
rno05167  Kaposi's sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    25734 (Hck)
   04062 Chemokine signaling pathway
    25734 (Hck)
 Human Diseases
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    25734 (Hck)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     25734 (Hck)
Protein kinases [BR:rno01001]
 Non-receptor tyrosine kinases
  SRC family
   25734 (Hck)
Membrane trafficking [BR:rno04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Kinases and associated proteins
    25734 (Hck)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase SH2 SH3_1 SH3_9 SH3_2 Haspin_kinase ABC1
Motif
Other DBs
NCBI-GeneID: 25734
NCBI-ProteinID: NP_037317
RGD: 2785
Ensembl: ENSRNOG00000009331
UniProt: P50545
Position
3q41
AA seq 524 aa AA seqDB search
MGGRSSCEDPGCPRGEGRVPRMGCVKSRFLREGSKASKIEPNANQKGPVYVPDPTSPKKL
GPNSINSLPPGVVEGSEDTIVVALYDYEAIHREDLSFQKGDQMVVLEESGEWWKARSLAT
KKEGYIPSNYVARVNSLETEEWFFKGISRKDAERHLLAPGNMLGSFMIRDSETTKGSYSL
SVRDFDPQHGDTVKHYKIRTLDSGGFYISPRSTFSSLQELVVHYKKGKDGLCQKLSVPCV
SPKPQKPWEKDAWEIPRESLQMEKKLGAGQFGEVWMATYNKHTKVAVKTMKPGSMSVEAF
LAEANLMKTLQHDKLVKLHAVVSQEPIFIVTEFMAKGSLLDFLKSEEGSKQPLPKLIDFS
AQISEGMAFIEQRNYIHRDLRAANILVSASLVCKIADFGLARIIEDNEYTAREGAKFPIK
WTAPEAINFGSFTIKSDVWSFGILLMEIVTYGRIPYPGMSNPEVIRALEHGYRMPRPDNC
PEELYSIMIRCWKNRPEERPTFEYIQSVLDDFYTATESQYQQQP
NT seq 1575 nt NT seq  +upstreamnt  +downstreamnt
ctggggggtcgttcgagctgcgaggatccgggctgcccgcgaggcgaagggcgggtgccc
aggatgggatgtgtgaagtccaggttcctccgagaaggaagcaaggcctcaaaaatagag
ccaaatgccaaccagaaaggccctgtgtatgtgccggatcccacgtcccctaagaagctg
ggaccgaacagcatcaacagcctgcccccgggggtcgtggagggctctgaggacaccatt
gtggtcgcactgtacgactatgaggccattcaccgtgaagacctcagcttccagaaggga
gaccagatggtggttctggaggagtctggggagtggtggaaggcccgttccctggctacc
aagaaagaaggctatatcccaagcaattatgtagctcgagttaactctttggagactgag
gagtggttcttcaagggtatcagccggaaggatgcagagcgccacctgctggctcccggg
aacatgctgggctccttcatgatccgggacagtgagaccaccaaagggagctactcactt
tctgttcgagactttgacccccagcacggagacacggtgaagcattataaaatccggaca
ctggacagtggaggcttctacatctctccgaggagcaccttcagcagcctgcaggaactt
gtcgtccactacaagaaggggaaggatgggctctgccagaagctgtcagtgccctgtgtg
tctcccaaaccccagaagccatgggagaaagatgcctgggagattcctcgagaatccctc
cagatggagaagaaactgggagccgggcagtttggagaagtgtggatggccacctacaac
aagcacaccaaagtggcggtgaagacaatgaagccagggagcatgtctgtggaggccttc
ctggcagaggccaacctgatgaagacgttacagcatgataaactggtgaagctgcacgcc
gtggtctctcaggagcccatctttattgtcaccgagttcatggccaaaggaagcctgctg
gactttctcaagagtgaagaaggcagcaagcagccactgccaaaactcattgacttctca
gcccagatttcagagggcatggctttcattgagcagaggaactacatccaccgagacctc
cgggctgccaacatcttggtttctgcatcactggtgtgtaagatcgctgactttggactg
gcacggatcatcgaggacaatgagtacacagctcgggaaggagccaagttccccatcaag
tggacagctcctgaagccatcaactttggctccttcaccatcaagtcagatgtctggtcc
tttggtatcctgctgatggaaatcgtcacctacggccggatcccttacccaggtatgtca
aacccagaggtgattcgagcactagagcatgggtaccgtatgcctcgaccagataactgc
ccagaggagctctacagtatcatgatccgctgctggaagaaccgtccagaggaacggccc
actttcgaatacatccagagcgtgctggatgacttctacacggccactgagagccagtat
cagcagcaaccttga

DBGET integrated database retrieval system