KEGG   Rattus norvegicus (rat): 25741Help
Entry
25741             CDS       T01003                                 

Gene name
Pfkl, ATP-PFK, PFK-L
Definition
phosphofructokinase, liver (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
HIF-1 signaling pathway
AMPK signaling pathway
Central carbon metabolism in cancer
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    25741 (Pfkl)
   01230 Biosynthesis of amino acids
    25741 (Pfkl)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    25741 (Pfkl)
   00030 Pentose phosphate pathway
    25741 (Pfkl)
   00051 Fructose and mannose metabolism
    25741 (Pfkl)
   00052 Galactose metabolism
    25741 (Pfkl)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    25741 (Pfkl)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    25741 (Pfkl)
   04152 AMPK signaling pathway
    25741 (Pfkl)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    25741 (Pfkl)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     25741 (Pfkl)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     25741 (Pfkl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
20p12
AA seq 780 aa AA seqDB search
MATVDLEKLRMSGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVE
GGENIKPANWLSVSNIIQLGGTIIGSARCKAFTTREGRLAAAYNLLQHGITNLCVIGGDG
SLTGANIFRNEWGSLLEELVKEGKISESTAQNYAHLSIAGLVGSIDNDFCGTDMTIGTDS
ALHRIMEVIDAITTTAQSHQRTFVLEVMGRHCGYLALVSALASGADWLFIPEAPPEDGWE
NFMCERLGETRSRGSRLNIIIIAEGAIDRHGKPISSSYVKDLVVQRLGFDTRVTVLGHVQ
RGGTPSAFDRVLSSKMGMEAVMALLEATPDTPACVVSLSGNQSVRLPLMECVQVTKDVQK
AMDEKRFDEAIQLRGRSFENNWKIYKLLAHQKVSKEKSNFSLAILNVGAPAAGMNAAVRS
AVRTGISEGHTVYVVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKPHLEAI
VENLRTYNIHALLVIGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLG
SDTAVNAAMESCDRIKQSASGTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFN
IHDLKANVEHMTEKMKTDIQRGLVLRNEKCHEHYTTEFLYNLYSSEGRGVFDCRTNVLGH
LQQGGAPTPFDRNYGTKLGVKAMLWMSEKLRDVYRKGRVFANAPDSACVIGLRKKVVAFS
SVTELKKETDFEHRMPREQWWLNLRLMLKMLAHYRISMADYVSGELEHVTRRTLSIDKGF
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atggctaccgtggacctggagaagttgcggatgtcgggggctggcaaggccatcggagtg
ctgacaagcggcggtgacgcgcaaggtatgaatgctgctgtcagggctgtgactcgtatg
ggcatatatgtgggggccaaagtcttcctcatctacgagggctacgagggcctcgtggaa
ggaggcgagaacatcaagccagccaactggctcagtgtctccaacatcatccagctgggc
ggcaccatcattggcagtgcccgctgtaaggccttcactacgagggaagggcgcctggca
gcggcctacaatctgctccaacacggcatcaccaacctgtgtgtcatcggtggggatggc
agcctcacgggggccaacatcttccgcaacgagtggggcagcttgctggaggaactggtg
aaggaaggcaagatctcagagtccacagctcagaactacgcacacttgagcatcgccggt
ctggtgggctccatcgacaacgacttctgcggcaccgacatgaccatcggcacggactcg
gccctgcaccggatcatggaggtcatcgacgccatcaccaccactgcccagagccaccag
aggacctttgtgttggaggtgatgggacggcactgcgggtacctggcgctggtgtctgcg
ctggcctccggggctgattggctgttcatccctgaagcgcccccggaggatggctgggag
aacttcatgtgtgagaggctgggggagactcggagccgggggtctcgactgaacatcatc
atcatcgcggagggtgccatcgaccggcatggaaagcctatctcatccagctacgtgaaa
gacctggtggttcagaggctgggcttcgatacacgagtgaccgtgctgggccacgtacag
cgaggagggacaccctcggcctttgaccgagtcctgagtagcaagatgggtatggaggcc
gtgatggcgctgctggaggccacgccggacacgccggcctgcgtggtcagcctctccggg
aatcagtctgtgcggctgcctctcatggagtgtgtgcaagtgacgaaggatgtgcagaag
gccatggatgagaagaggtttgacgaggccatccagctccgtggcaggagcttcgagaac
aactggaaaatttacaagctcctcgcccaccagaaggtgtctaaggagaagtccaacttc
tccctggccatcctgaatgtgggagctccagcggccggcatgaacgcagccgtgcgctcc
gcggtacgcactggcatctccgagggacacacagtgtacgttgtgcatgatggctttgag
ggcctggccaagggtcaggtgcaagaagtgggctggcatgatgtggcaggttggctagga
cgtggtggctcaatgctggggaccaagaggaccctgcccaagccccacctggaggccatt
gtagaaaatctccgtacctacaacattcatgccctgttggtgatcggtggctttgaggcc
tacgagggtgtgctgcagctggtggaggctagggggcgctacgaggaactctgtatcgtc
atgtgcgtcatcccagccaccatcagcaacaatgtccctggcactgacttcagcctgggc
tcggacacggccgtcaacgctgcaatggagagttgtgaccgcatcaaacaatcggcctcg
gggacaaagcggcgtgtgttcattgtagagaccatggggggctactgtggctacctggcc
actgtgacaggcattgctgtgggcgccgatgccgcctacgtctttgaggaccctttcaac
atccacgacttgaaggccaatgtggagcatatgacagagaagatgaagacagacatccag
aggggcctggtgctccggaacgagaagtgtcacgaacactacaccacggaattcctatac
aacctatactcctcggaaggcagaggtgtgttcgactgcaggaccaacgtgctgggccac
ctgcagcagggtggcgctccaacccccttcgaccggaactatgggaccaaactgggggtg
aaggccatgttgtggatgtcggagaagctgcgtgatgtctaccgcaaagggcgggtgttt
gccaatgctccggactcagcctgtgtgatcggcctgaggaagaaggtggtggccttcagt
tcggtcacagaactcaagaaagagacagattttgagcaccgtatgccgcgggagcagtgg
tggctgaatctgcggctgatgctgaagatgttggcacactaccgcatcagcatggccgac
tacgtgtctggggagctggagcacgtcacacgccgcaccttgagcatagacaagggtttc
tga

DBGET integrated database retrieval system