KEGG   Rattus norvegicus (rat): 25743Help
Entry
25743             CDS       T01003                                 

Gene name
Kcnj6
Definition
(RefSeq) potassium voltage-gated channel subfamily J member 6
  KO
K05000  potassium inwardly-rectifying channel subfamily J member 6
Organism
rno  Rattus norvegicus (rat)
Pathway
rno04713  Circadian entrainment
rno04723  Retrograde endocannabinoid signaling
rno04725  Cholinergic synapse
rno04726  Serotonergic synapse
rno04727  GABAergic synapse
rno04728  Dopaminergic synapse
rno04915  Estrogen signaling pathway
rno04921  Oxytocin signaling pathway
rno05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Endocrine system
   04915 Estrogen signaling pathway
    25743 (Kcnj6)
   04921 Oxytocin signaling pathway
    25743 (Kcnj6)
  Nervous system
   04727 GABAergic synapse
    25743 (Kcnj6)
   04725 Cholinergic synapse
    25743 (Kcnj6)
   04728 Dopaminergic synapse
    25743 (Kcnj6)
   04726 Serotonergic synapse
    25743 (Kcnj6)
   04723 Retrograde endocannabinoid signaling
    25743 (Kcnj6)
  Environmental adaptation
   04713 Circadian entrainment
    25743 (Kcnj6)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    25743 (Kcnj6)
Ion channels [BR:rno04040]
 Related to voltage-gated cation channels
  Inward rectifier channel (Kir)
   25743 (Kcnj6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IRK Ion_trans_2
Motif
Other DBs
NCBI-GeneID: 25743
NCBI-ProteinID: NP_037324
RGD: 2959
Ensembl: ENSRNOG00000001658
UniProt: P48550 Q54A91
Position
11q11
AA seq 425 aa AA seqDB search
MTMAKLTESMTNVLEGDSMDQDVESPVAIHQPKLPKQARDDLPRHISRDRTKRKIQRYVR
KDGKCNVHHGNVRETYRYLTDIFTTLVDLKWRFNLLIFVMVYTVTWLFFGMIWWLIAYIR
GDMDHIEDPSWTPCVTNLNGFVSAFLFSIETETTIGYGYRVITDKCPEGIILLLIQSVLG
SIVNAFMVGCMFVKISQPKKRAETLVFSTHAVISMRDGKLCLMFRVGDLRNSHIVEASIR
AKLIKSKQTSEGEFIPLNQTDINVGYYTGDDRLFLVSPLIISHEINQQSPFWEISKAQLP
KEELEIVVILEGMVEATGMTCQARSSYITSEILWGYRFTPVLTLEDGFYEVDYNSFHETY
ETSTPSLSAKELAELANRAELPLSWSVSSKLNQHAELETEEEEKNPEELTERNGDVANLE
NESKV
NT seq 1278 nt NT seq  +upstreamnt  +downstreamnt
atgacaatggccaagttaactgaatccatgactaatgtcctggagggggattccatggac
caagacgtggaaagcccagtggccattcaccagccaaagttgcctaagcaggccagggat
gacctgccaagacacatcagccgagacaggaccaaaaggaaaatccagaggtacgtgagg
aaggatgggaagtgtaacgtccaccacggcaacgtgcgggagacgtaccgatacctgacg
gacatcttcaccaccctggtggacctaaagtggagattcaacctattgatctttgtcatg
gtctacacagtgacgtggcttttctttgggatgatctggtggctaattgcatacatccgg
ggagatatggaccacatagaggacccctcgtggactccctgtgttaccaacctcaacggg
tttgtctccgcttttttattctcaatagagacagaaaccaccattggttatggctacagg
gtcatcacggacaagtgcccagaaggaattattctcctcttaatccagtccgtgttgggg
tccattgtcaacgccttcatggtaggatgtatgtttgtgaaaatatcccaacccaagaag
agggcagagaccctggtcttttccacccatgcggtaatctccatgcgggatgggaaacta
tgcctgatgttccgggtaggggacttgaggaattcccacattgtggaggcctccatcaga
gccaagttgatcaagtccaaacagacttcagagggggagttcattcccctcaaccagacg
gatatcaacgtagggtactacaccggggatgaccgactctttctcgtgtcaccgctgatt
attagccatgaaattaaccaacagagtcccttctgggagatctccaaagcccagctgcct
aaagaggaactggagattgtggtcatcctggagggaatggtggaagccacaggaatgacg
tgccaagctcgaagctcctacatcaccagtgagatcctgtggggttaccggttcacacca
gtcctgacactggaggacgggttctatgaagttgactacaacagcttccatgagacctat
gagaccagcaccccgtcccttagcgccaaagagctagccgagctggctaaccgggcagag
ctgcccctgagctggtctgtgtccagcaaactgaaccaacatgcagaactggagacggaa
gaggaagagaagaacccggaagaactgacagagaggaatggtgatgtggcaaacctagag
aatgagtccaaagtgtag

DBGET integrated database retrieval system