KEGG   Rattus norvegicus (rat): 259167Help
Entry
259167            CDS       T01003                                 

Gene name
Art5, ARTC5
Definition
ADP-ribosyltransferase 5 (EC:2.4.2.31)
Orthology
K00775  
NAD(P)-arginine ADP-ribosyltransferase [EC:2.4.2.31]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.31  NAD+---protein-arginine ADP-ribosyltransferase
     259167 (Art5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q32
AA seq 308 aa AA seqDB search
MILEDLLMVLSCLALHILWKVQAVPILPLSLVPDTFDDAYVGCSEEMEEKAGLLLKEEMA
RHALLRESWEAAQEAWAHGRHKLTLPPGFKAQHGVAVMVYTNSSNTLYWELNQAVRTGGR
SRELYMRHFPFKALHFYLTRALQLLRGTGGCSREAGEVVFRGVSSLHFEPKRLGDSVRLG
QFASSSVDERVARRFGNATFFNLRTCFGAPIQALSVFPEEREVLIPPHEVFLVTGFSQDG
AQSIVTLWSYNQTCSHFNCAYLGGEKRRGCVSSRAGQPESFSTEALALQSGKTLLLAPGE
LQLSRAGP
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgattctggaggatcttctgatggtcctcagctgcctcgccttgcacatcctctggaag
gtacaagctgtccctatcctgcccctgagcctggttccggataccttcgatgatgcctat
gtgggctgctctgaggagatggaggagaaagcaggcctgctgctaaaggaagagatggca
cgccatgccctgctacgggaatcctgggaagcagcgcaagaggcctgggcacacgggcgt
cacaagcttactctacctcctggcttcaaagcccagcacggagtagctgttatggtgtac
accaactcatccaacaccttgtactgggagctgaaccaggctgtgcggacaggaggtcgc
tcccgggagctctacatgaggcacttccccttcaaggccctgcatttctacttgacccgg
gccctgcagctgctgcggggcactggaggatgcagtagggaagctggggaggtggtgttc
cgaggtgtgagcagccttcactttgaacccaagaggctgggggactctgtccggttagga
cagtttgcctccagctctgtggatgaaagagtggctcgcaggtttggcaacgccaccttc
ttcaatctaaggacttgttttggggctcctatccaggctctgtctgtcttccctgaggag
cgtgaggtgctgatacccccacatgaagtcttcttggtcactgggttctcccaggatgga
gcccagagcatagtgacgctctggagttataatcagacctgcagccactttaactgcgcc
tatttgggtggggagaagagacgtggctgtgtgtcctcaagagcagggcagccagagtcg
ttctccacagaggctttggctctgcaatcagggaagacgctgctcttggcccctggggag
ttgcagctctccagagctggaccctga

DBGET integrated database retrieval system