KEGG   Rattus norvegicus (rat): 261730Help
Entry
261730            CDS       T01003                                 

Gene name
Aurka, ARK-1, Stk6
Definition
aurora kinase A (EC:2.7.11.1)
Orthology
K11481  
aurora kinase A [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Oocyte meiosis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Cell growth and death
   04114 Oocyte meiosis
    261730 (Aurka)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     261730 (Aurka)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: Other group
  Aur family [OT]
   261730 (Aurka)
Protein phosphatases and associated proteins [BR:rno01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     261730 (Aurka)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
3q42
AA seq 397 aa AA seqDB search
MDRCKENCVSRPVKSTVPFGPKRVLVTEQIPSQHPGSASSGQAQRVLCPSNSQRVPPQAQ
KPVAGQKPVLKQLPAASGPRPASRLSNPQKSEQPQPAASGNNSEKEQTSIQKTEDSKKRQ
WTLEDFDIGRPLGKGKFGNVYLAREKQSKFILALKVLFKVQLEKAGVEHQLRREVEIQSH
LRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYC
HSKRVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRMHD
EKVDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGARDLISRLLKHN
SSQRLTLAEVLEHPWIKANSSKPPTGHNSKEATSKSS
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atggacagatgtaaagaaaactgtgtctctaggcctgtcaagtccactgttcccttcggt
ccgaaacgagtcttggtgactgagcagattccttctcagcacccaggatcagcgagcagt
ggccaggcccagcgggtcctgtgtccctccaactcccagcgtgtccctccacaagcacag
aaacctgtcgcaggtcagaagccagtgctcaagcagttgccggctgccagcggtcctcga
cctgcttcccggctgagtaacccccagaagagtgagcagccacagcctgcggcctcggga
aataattctgaaaaggaacagacatccatccagaaaactgaagactcaaaaaaaaggcag
tggactttggaagattttgacatcggccgcccactaggaaaagggaagtttggaaatgtc
tacttggcgagggagaagcaaagcaagttcatcctggctctgaaggtgctgtttaaagta
cagctggagaaggcaggtgtggagcaccagctccggagagaagtggagatccagtcccac
ctgcggcaccccaacatcctcaggctgtatgggtatttccatgacgccaccagagtttat
ttaattctggaatacgcgccccttggaacagtatatagagagcttcaaaaactctccaag
tttgatgagcagagaacagctacctacatcacggagttggcgaatgctttgtcctactgc
cactcaaagagagtcatccacagagacatcaagccagagaacctgctgcttggctcaaat
ggggagttgaagatcgcagactttgggtggtctgtgcatgctccgtcttccaggagaacc
acgctgtgtggcaccctggactacctgcccccggagatgattgaaggtcggatgcatgac
gagaaggtggacctctggagcctgggggtgctctgctatgagttcctagtggggatgcct
ccttttgaggcacacacttatcaggagacctacagaaggatatcacgggttgaattcaca
ttccctgactttgtgacggagggagccagggacctcatttcaagactgttaaaacacaac
tcaagtcaaaggctaacactagcggaagtccttgagcacccttggatcaaagctaattct
tcaaaacctccgactggccacaatagcaaagaggcaactagcaaatcgtcttag

  All links  
No link information was found.   
DBGET integrated database retrieval system