KEGG   Rattus norvegicus (rat): 266682Help
Entry
266682            CDS       T01003                                 

Gene name
Cyp3a2, Cyp3a11
Definition
cytochrome P450, family 3, subfamily a, polypeptide 2 (EC:1.14.14.1)
Orthology
K07424  
cytochrome P450, family 3, subfamily A [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Steroid hormone biosynthesis
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    266682 (Cyp3a2)
   00591 Linoleic acid metabolism
    266682 (Cyp3a2)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    266682 (Cyp3a2)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    266682 (Cyp3a2)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     266682 (Cyp3a2)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP3 family
   266682 (Cyp3a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
12p11
AA seq 504 aa AA seqDB search
MDLLSALTLETWVLLAVILVLLYRLGTHRHGIFKKQGIPGPKPLPFLGTVLNYYKGLGRF
DMECYKKYGKIWGLFDGQTPVFAIMDTEMIKNVLVKECFSVFTNRRDFGPVGIMGKAVSV
AKDEEWKRYRALLSPTFTSGRLKEMFPIIEQYGDILVKYLKQEAETGKPVTMKKVFGAYS
MDVITSTSFGVNVDSLNNPKDPFVEKTKKLLRFDFFDPLFLSVVLFPFLTPIYEMLNICM
FPKDSIAFFQKFVHRIKETRLDSKHKHRVDFLQLMLNAHNNSKDEVSHKALSDVEIIAQS
VIFIFAGYETTSSTLSFVLYFLATHPDIQKKLQEEIDGALPSKAPPTYDIVMEMEYLDMV
LNETLRLYPIGNRLERVCKKDIELDGLFIPKGSVVTIPTYALHHDPQHWPKPEEFHPERF
SKENKGSIHPYVYLPFGNGPRNCIDMRFALMNMKLALTKVLQNFSFQPCKETQIPLKLSR
QAILEPEKPIVLKVLPRDAVINGA
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atggacctgctttcagctctcacactggaaacctgggtcctcctggcagtcatcctggtg
cttctctaccgacttggaacccatagacatggaatttttaagaaacaaggaattcctggg
ccaaaacctctgccctttttaggcactgtgctgaattactacaagggcttagggagattt
gacatggagtgctataaaaagtatggaaaaatatgggggttgtttgatggtcaaacgcct
gtgtttgccatcatggacacagagatgattaagaatgtactagtgaaggaatgcttttct
gtcttcacaaaccggcgggattttggcccagtggggattatggggaaagctgtctctgta
gctaaggatgaggagtggaagagatatagagccttgctgtcccccacgttcaccagtgga
agactcaaggagatgttccccatcattgaacagtatggagacattttggtaaagtacttg
aagcaagaggcggagacaggcaagcctgtcaccatgaaaaaagtgtttggtgcctacagc
atggatgtgatcaccagcacatcatttggagtgaacgtcgattcccttaacaacccaaag
gatccttttgtggagaaaaccaagaaattgttaagatttgacttttttgatccgttgttc
ttgtcagtagtactctttccattcctcaccccaatatatgagatgctaaatatctgcatg
ttcccaaaggattcaatagcatttttccaaaaatttgtgcacagaataaaggaaacccgt
ctggattctaagcataagcaccgagtggattttctccagctgatgctgaacgctcataat
aattccaaagacgaagtgtctcataaagccctgtctgatgttgaaatcatagcccagtca
gttatctttatttttgctggctatgaaaccaccagcagcacactctcctttgtcttgtat
ttcctggccactcaccctgatattcagaagaaactgcaggaggagatcgatggggccctg
ccgagtaaggcacctcctacctacgatattgtgatggaaatggaatacctggatatggtg
ttgaatgaaactctcagattgtatccaattggtaatagacttgagagagtctgtaaaaaa
gatatagaacttgatggtttgtttatacccaaagggtcagtagtgacgattccaacatat
gctcttcatcatgacccacagcactggccaaagcctgaggaatttcatccagaaaggttt
agcaaggagaacaagggaagcattcatccttatgtatatctgccctttggaaatggaccc
aggaactgcattgacatgaggtttgctctcatgaatatgaaactcgctctcactaaagtt
ctgcaaaacttctccttccagccttgcaaggaaacacagatacctctgaaattgagtaga
caagcaattcttgaaccagaaaaacccattgttctaaaggttctgccacgggatgcagtc
ataaatggagcctga

DBGET integrated database retrieval system