KEGG   Rattus norvegicus (rat): 266685Help
Entry
266685            CDS       T01003                                 

Gene name
Ugt2b17, Rlug38, UDPGT_2B5, Udpgt, Udpgtr-3, Ugt2b3, Ugt2b5
Definition
UDP glucuronosyltransferase 2 family, polypeptide B15 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    266685 (Ugt2b17)
   00053 Ascorbate and aldarate metabolism
    266685 (Ugt2b17)
   00500 Starch and sucrose metabolism
    266685 (Ugt2b17)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    266685 (Ugt2b17)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    266685 (Ugt2b17)
   00860 Porphyrin and chlorophyll metabolism
    266685 (Ugt2b17)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    266685 (Ugt2b17)
   00982 Drug metabolism - cytochrome P450
    266685 (Ugt2b17)
   00983 Drug metabolism - other enzymes
    266685 (Ugt2b17)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    266685 (Ugt2b17)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     266685 (Ugt2b17)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   266685 (Ugt2b17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
14p21
AA seq 530 aa AA seqDB search
MPGKWISALLLLQISCCFQSGNCGKVLVWPMEFSHWMNIKTILDELVQRGHEVTVLKPSA
YYVLDPKKSPDLKFETFPTSVSKDELENYFIKLVDVWTYELQRDTCLSYSPLLQNMIDGF
SDYYLSLCKDTVSNKQLMAKLQESKFDVLLSDPVAACGELIAEVLHIPFLYSLRFSPGYK
IEKSSGRFILPPSYVPVILSGMGGPMTFIDRVKNMICTLYFDFWFHMFNAKKWDPFYSEI
LGRPTTLAETMGKAEMWLIRSYWDLEFPHPTLPNVDYIGGLQCRPPKPLPKDMEDFVQSS
GEHGVVVFSLGSMVSSMTEEKANAIAWALAQIPQKVLWKFDGKTPATLGPNTRVYKWLPQ
NDLLGHPKTKAFVTHSGANGVYEAIYHGIPMVGIPMFGEQHDNIAHMVAKGAAVTLNIRT
MSKSDLFNALKEIINNPFYKKNAVWLSTIHHDQPMKPLDKAVFWIEFVMRHKGAKHLRPL
GHDLPWYQYHSLDVIGFLLTCSAVIAVLTVKCFLFIYRLFVKKEKKMKNE
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcctgggaagtggatttctgctcttctcctgctacagataagttgctgtttccaatct
gggaactgtgggaaggtgttggtgtggccgatggaattcagccactggatgaatataaaa
acaatactggatgaacttgtacagaggggccatgaagtcactgttctgaaaccttcggct
tactatgttcttgatccgaaaaaatcgccagatcttaagtttgaaactttccctacatct
gtcagtaaagatgaactggaaaattatttcataaagcttgtggatgtgtggacttatgag
ttgcaaagagatacatgtttgtcttattctcctttactacaaaatatgatagatggattt
tctgattactatctaagtctttgtaaagacaccgtttcaaacaagcagctcatggcaaaa
ctacaggaatccaagtttgatgttcttttgtcagatcctgtggctgcctgtggggagctg
atagccgaagtgctccacattccttttctgtacagtcttcgcttctctccaggctacaaa
attgaaaagtccagtggaagatttatattacctccatcttatgtaccagtaattttgtca
ggaatgggtggcccaatgacattcatagacagggtaaaaaatatgatatgtacgctttat
tttgacttttggttccatatgtttaatgccaagaaatgggatccattttacagtgagatt
ttgggaaggcccaccaccttagctgagacaatgggcaaagcagaaatgtggctcattaga
tcctactgggatttggaatttccccacccaacattaccaaatgttgactatattggagga
ctccaatgcagacctcctaaacccttgcccaaggatatggaagattttgtccagagctct
ggagagcatggcgtggtggtgttttctctggggtcaatggtcagcagcatgacagaagaa
aaggccaatgcaattgcatgggcccttgcccagattccacaaaaggttctttggaaattt
gatggcaaaaccccagcaaccttaggacccaataccagagtctacaagtggcttccccag
aatgacctccttggtcatccaaaaaccaaagcctttgtaactcatagtggagccaatggt
gtctatgaggccatctatcatggaatccctatggttggcattcctatgtttggagaacaa
catgataacattgcccacatggtggccaaaggagcagctgttacactgaatatcaggaca
atgtcaaagtcagatttgttcaatgcactaaaggaaataataaacaatccattctataaa
aaaaatgctgtgtggttgtcaaccattcaccatgaccaacctatgaagcccctggacaag
gctgtcttctggattgagtttgtcatgcgccacaaaggggccaagcacctgaggccactt
ggacatgaccttccctggtaccagtaccactctctggatgtgattggattcctgctcacc
tgttcggcagtcattgcagtccttactgtaaaatgcttcttgtttatttaccgactcttt
gtgaagaaggaaaagaaaatgaagaatgagtag

  All links  
No link information was found.   
DBGET integrated database retrieval system