KEGG   Rattus norvegicus (rat): 286906Help
Entry
286906            CDS       T01003                                 

Gene name
Pdia6, CaBP1, P5, Txndc7
Definition
protein disulfide isomerase family A, member 6 (EC:5.3.4.1)
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    286906 (Pdia6)
Enzymes [BR:rno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     286906 (Pdia6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
6
AA seq 445 aa AA seqDB search
MRVISMARLVLGLVSCTFFLAVSALYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWC
GHCQRLTPEWKKAASALKDVVKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQ
GGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRGDSSSKKDVVELTDDTFDKNVL
DSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATVNQVLASRYGIK
GFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPELLEIINEDIAKKTCEEHQ
LCVVAVLPHILDTGATGRNSYLEVLLKLADKYKKKMWGWLWTEAGAQYELENALGIGGFG
YPAMAAINARKMKFALLKGSFSEQGINEFLRELSFGRGSTAPVGGGSFPNITPREPWDGK
DGELPVEDDIDLSDVELDDLEKDEL
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtgatcagcatggctcgactagtgctcggtctggtgagctgtaccttctttcta
gcggtcagtgctctctattcctccagtgatgatgtcatcgagttaacgccatcaaatttc
aacagagaagttattcagagtgatagtctgtggcttgtagaattttatgcaccatggtgt
ggtcattgccaaaggttaacaccagagtggaagaaagcagcaagtgcactgaaagatgtt
gttaaagtcggtgcagtcaatgcagataaacatcagtccctgggaggtcagtatggtgtc
cagggatttcctaccatcaagatatttggagctaacaaaaacaaaccagaagattaccag
ggtggcagaactggagaagccattgtagatgccgccctcagtgctttgcgccagcttgtg
aaggatcgccttggtgggcgaagtggcgggtacagttctggaaagcagggcagaggtgat
agttcaagtaagaaggacgtggtcgagctgacggatgacacctttgataagaatgtcctt
gacagtgaagacgtttggatggttgagttttatgctccatggtgtggacactgcaaaaac
ttggagccagaatgggctgctgcagccacagaggtaaaggagcaaacgaagggaaaggtg
aaattggcagccgtagatgccaccgtgaatcaggttctggccagccggtatgggattaaa
ggattccctacaatcaagatatttcagaaaggcgagtctcctgtggactatgatggtgga
cggacgagatctgacatagtgtcaagggccctggatttgttctctgataatgcgccaccc
ccagagctgctcgagataatcaacgaagacatagccaagaagacatgcgaggaacaccag
ctctgtgtggtggccgtgctgcctcacatcctggacaccggagctacaggtagaaactct
tacttggaagttcttctgaaactggctgacaagtacaagaagaaaatgtgggggtggctg
tggacggaagctggagcccagtatgagctggagaacgcactagggatcggagggtttggg
taccctgccatggcagccatcaatgcccgcaagatgaagtttgctcttctcaaaggctct
ttcagtgaacaaggcatcaatgagtttctcagggaactgtctttcgggcgtggctccaca
gcacccgtagggggtggttccttccctaacatcactcccagggagccctgggatggcaag
gatggcgagcttcctgtggaggacgacattgacctcagtgatgtggagctcgatgaccta
gagaaggacgagttgtga

DBGET integrated database retrieval system