KEGG   Rattus norvegicus (rat): 286931Help
Entry
286931            CDS       T01003                                 

Gene name
Unc13c, Unc13h3
Definition
unc-13 homolog C (C. elegans)
Orthology
K15293  
protein unc-13
Organism
rno  Rattus norvegicus (rat)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:rno00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    286931 (Unc13c)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
8q24
AA seq 2204 aa AA seqDB search
MVASLFKSLILAYIHKLCKGMFTKKLGNTTKKKENRQQNKDQDFPTAGHTKPPKLSNALK
STVKKIAKCSSTRNFSVEDEEGHKDFSLSPTFSYRVAIANGLQTAVTNSDEDLLQELSSI
ESSYSESFNELRSSTENQVQSTHTMPVRRNRKSSSSLAPSEGSSDGERTLHTLKLGALRK
LRKWKKSQECVSSDSELSTVKKTWGIRSKSLDRTARNPKTNVLEPGFSSSGCISQTHDVM
EMIFKELQGISQIETELSELRGHVNALKYSIDEISSSVEVVQSEIEQLRTGFVQARRETR
DIHDYIKHLGHMGSKVSLRFLNVPEERHEYVESVVYQILVDKMGFSDVPNAIKIEFAQRI
GQQRDCPNAKPRPILVYFETPQQRDSVLKKSYKLKGTGIAISTDILTYDIRERKEKGVLP
SSQTYESMDMKLSTPEPKAKKNAWLSPNDSDRELESDLSRSSYADSPAKGSSSKSSSKSH
SARSKNKAANSRTSQKSDYNKRPSKPPASEKPTPHYVEATPLWHSQSDFFTPKLSRSESD
FSKLCQSYSEDFSESQFFCRTNGSSLLSSSDRELWQRKQEGMTALYHSPQDQGLDGNIPT
VPGQGEIENTETVDSGMSNSVVCASGDRSNYSGSQLSLHEDLSPWKEWNQAGHGTDGLDS
STQEPFDYDTNSLSDQQLDMSSKDLDDLGKCHSDLQDDSESYDLTQDDNSSPCPGLDNEP
QGQWVGQYDSYQKTNSNDLYPNQSHPSMMYRSQSELQSDDSEAAQPKSWHSRLSIDLSDK
TFKFPKFGSTLQRAKSALEVVWNKSTQSLSGCEDSGSSLMGRFRTLSQSTANESSTTLDS
DIYTEPYYYKAEEEEDYCEPVADSETDYVEVMEQVLAKLENRTSVTEVDEHIKEYDHPSY
ETPYETPQDEGYDGQADDIISEGELETLNEPAVEMELVEDESQNLPVEPPEVMKPKRIRP
SFKEAALRAYKKQMAELEEKILAGDSSSVDEKARIVSGNDLDASKFSALQVFGGAGRGLY
GIDSMPDLRRKKTLPIVRDVAMTLAARKSGLSLAMVIRTSLNNEELKMHVFRKTLQALIY
PISSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCHEKCQDLLNADCLQR
AAEKSSKHGAEDKTQTIITAMKERMKIRERNRPEVFEVIQEMFQISKEDFVQYTKAAKQS
VLDGTSKWSAKITITVVSAQGLQAKDKTGSSDPYVTVQVGKNKRRTKTIFGNLNPVWDEK
FYFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIVEVRTLSGEMDVWYNLE
KRTDKSAVSGAIRLKINVEIKGEEKVAPYHIQYTCLHENLFHYLTEVKSNGSVKIPEVKG
DEAWKVFFDDASQEIVDEFAMRYGVESIYQAMTHFSCLSSKYMCPGVPAVMSALLANINA
FYAHTTVSTNVQVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSKYRENFPASNSERLQ
DLKSTVDLLTSITFFRMKVLELQSPPKASAVVKDCVRACLDSTYKYIFDNCHELYSQLID
PSKKQDVPREEQGPTTKNLDFWPQLITLMVTIIDEDKTAYTPVLNQFPQELNMGKISAEI
MWSLFALDMKYALEEHEKQRLCKSTDYMNLHFKVKWFYNEYVRELPAFKDAVPEYSLWFE
PFVMQWLDENEDVSMEFLHGALGRDKKDGFQQTSDHALFSCSVVDVFAQLNQSFEIIKKL
ECPNPEALSHLMRRFAKTINKVLVQYAAIVSSDFSSYCDKETVPCILMNNIQQLRVQLEK
MFESMGGKELDPEASTILKELQIKLNGVLDALSVTYGESFQLVIEECIKQMGAELNQMRA
NGNSAANKNNAAMDAEIVLRPLMDFLDKILSLSAKICEKTVLKRVLKELWKLVLNKIEKQ
IVLPPLTDQTGPQMIFIAAKELGQLSKLKEHMIRDDAKGLTPRQCAIMEVVLATIKQYFH
AGGNGLKKNFLEKSPDLHSLRYALSLYTQTTDALIKKFIETQGSQSRSSKDAVGQISVHV
DVTTTPGTGEHKVTVKVIAINDLNWQTTTMFRPFVEVCMLGPSLGDKKRKQGTKTKSNTW
SPKYNETFQFILGNENRPGAYELHLSVKDYCFAREDRIIGMTVIQLQNIAEKGSYGAWYP
LLKNLSMDETGLTILRILSQRTSDDVAKEFVRLKSETRSIDESA
NT seq 6615 nt NT seq  +upstreamnt  +downstreamnt
atggtggctagtctctttaagagcttgattttagcttatatacataagctttgcaaagga
atgtttacaaagaaattgggaaatacaaccaaaaagaaagaaaatcgtcagcagaataaa
gatcaagatttccctactgctggccacaccaaaccccctaaattgtccaatgccctgaaa
agcactgtaaaaaagattgcaaagtgctcatccacccgtaacttctccgtagaagacgaa
gaaggtcacaaagacttctccctgtcacccacattcagttaccgagttgctatcgccaat
ggcctgcaaacagctgtgaccaacagtgatgaggacctgcttcaggagctgtcttccatt
gagagctcatactctgaatccttcaatgagctaaggagcagcactgaaaaccaggttcag
tcaacccacaccatgccggtcaggcgtaacaggaagagctcaagcagcttggcaccctcc
gagggcagctcagatggggagcgcaccctccacaccttaaaactgggtgctctacggaag
ctgaggaaatggaagaagagccaagagtgtgtctcctcagactcggagttgagcactgtg
aagaaaacctggggtataagaagcaaatctttagatagaactgctcggaacccaaagacc
aatgttttggagccagggttcagctcctctggctgtattagccaaacccatgatgtcatg
gaaatgatctttaaagagcttcagggtataagtcagattgaaacagaactttctgaactc
cgaggccatgtaaatgctctcaagtactctatcgatgaaatctccagcagtgtggaggtt
gtccagagtgagattgaacagcttcggacaggatttgtccaggctcgaagggaaactaga
gatatccacgattacattaaacacttgggtcacatggggagtaaagtaagcctgagattt
ttaaatgtgcctgaagaaagacatgaatatgtggaaagtgtggtgtaccaaattcttgta
gataaaatgggtttctctgatgtaccgaatgctattaaaattgaatttgctcagaggata
gggcaacaaagggattgcccaaacgcaaaacctcgacccatcctagtgtactttgaaacc
cctcagcaaagggattctgtcttaaagaaatcatacaagctcaaaggcacaggcattgcg
atctccacagatattctaacttatgatatcagagaacggaaagagaaaggggtattacca
tcttctcagacatatgaaagcatggatatgaagttatccacaccagagcccaaagccaag
aagaatgcttggctgtcacccaatgacagtgacagagagctggagtcagaccttagcaga
agcagctatgctgactctccagcaaagggaagttcttctaagtccagctcaaagtcacac
agcgctcggtctaagaacaaagcagctaacagcagaacgtcacagaagtcggactacaac
aaacggccatccaaaccgccagcatcagaaaagccaacacctcactatgtggaagccaca
ccactctggcattcacagagtgacttcttcactcctaaacttagtcgctctgaatcagat
ttttccaaattgtgtcagtcttactcagaggatttttctgaaagtcagtttttctgtaga
actaatgggagctccctcctttcctcttctgaccgagagctttggcagaggaaacaggag
ggtatgactgccttgtaccacagtcctcaggaccagggtttagatgggaatattcctaca
gtaccagggcagggtgaaattgagaatacagaaacagtggacagtggtatgagcaacagt
gtggtgtgtgcatctggagaccgaagcaattatagtggttcccagctctcactgcatgag
gacctgtctccatggaaggagtggaatcaagcagggcacggaactgatggtttagattca
tctacccaggaaccttttgactatgacaccaacagtttatctgaccaacagttggacatg
tctagcaaagacctagatgaccttggcaagtgccacagtgacctgcaagatgactcagag
agctatgatttaacccaggatgacaactcttctccatgccctggattggataatgaacca
caaggccagtgggttggccagtatgattcttatcagaaaaccaactctaatgacctgtac
cccaaccaaagccatccatccatgatgtatcgaagtcaaagtgaattgcaaagcgatgat
tccgaggcggcccagcccaagtcctggcacagtcggctaagcattgacctttctgacaag
acctttaagttccccaaatttggatccactcttcagagggcgaagtcagccctggaagtg
gtgtggaacaagagcacacagagtctcagtgggtgtgaggacagcggctcttccttaatg
gggagatttcggacattgtctcagtccacggcaaatgagtcaagtaccacccttgactct
gatatctacacagaaccctattactataaagctgaggaagaggaggactactgtgaacca
gtggctgacagtgagacggattatgttgaagtgatggagcaggtcctagctaagctagaa
aacaggactagtgtgactgaagtagatgaacacattaaagagtacgaccacccttcctat
gaaactccttatgagaccccacaagatgagggttatgatgggcaggctgatgacatcatt
agtgaaggagaactggaaaccttaaatgagccagcagttgaaatggaattagtagaagat
gaaagccaaaacctccctgtagagccaccagaggtcatgaagccaaagagaatccgacct
tccttcaaagaagcagctttaagggcttataagaagcagatggcagagctggaagagaag
atcctggctggagacagcagctccgtggatgaaaaggctcgaatagtaagtggcaacgat
ttggatgcttccaaattctccgcactccaggtgttcggtggggctgggcgtggactttac
ggaatagacagcatgcctgatctccgcaggaaaaagacactgcctattgtacgggatgtg
gccatgaccctggctgcccggaaatctggtctatcccttgctatggttatcaggacatcc
ctgaacaatgaggagctgaaaatgcatgtcttccggaagaccttgcaggcattgatctac
cccatttcttctaccactcctcacaacttcgaggtctggacagctaccacacccacctac
tgctatgagtgtgaagggctgctgtggggcattgcaaggcaaggcatgaagtgtctggag
tgtggggtgaaatgtcacgagaagtgtcaggacctgctcaacgccgactgtctgcagcga
gcagcggagaagagctctaagcatggtgcagaggacaagacgcagaccatcatcacagcc
atgaaagaaagaatgaagatcagggagaggaacaggccagaggtgtttgaagtcattcag
gaaatgttccagatctccaaagaggattttgtgcagtacacaaaggctgccaagcagagc
gtgctagatggcacgtccaagtggtcagcgaaaataaccatcacagtggtttctgcacaa
ggcttgcaggcaaaagacaaaacagggtccagtgacccatatgtgacagttcaagttggc
aagaataaaagaagaacgaaaactatctttggaaacttgaatccggtgtgggatgagaag
ttctactttgagtgtcataactcgacagaccgaatcaaggtcagagtgtgggatgaagac
gacgacattaaatccagagtgaagcaacacttcaagaaggagtcagatgactttctggga
cagacgattgtcgaagtcaggactctgagtggcgagatggatgtctggtacaacttagag
aaacggacagataaatcagctgtgtctggggccatccgactaaaaatcaatgtggaaata
aagggagaggagaaggttgcaccgtatcatatacaatacacttgtttacacgagaacctg
ttccattacctgacagaagtgaagtctaatggcagcgtgaaaataccagaggtcaaaggc
gatgaagcctggaaggttttctttgatgatgcttctcaagaaatagtggatgaatttgcc
atgcgttatggggttgagtccatttatcaagctatgacgcacttttcatgtctgtcttct
aagtacatgtgcccgggtgtccctgcagtcatgagcgccctgctggcgaacatcaatgcc
ttctatgctcatacaactgtctccactaacgtgcaggtttctgcttctgatcgctttgct
gctacgaactttgggagggaaaaattcataaaactactggaccagttgcataactcctta
aggattgatctgtcaaaatacagggaaaactttccagccagcaacagtgagagactacag
gacctaaagtccactgtggacctgctgaccagcatcaccttcttccggatgaaggtcctg
gagctgcagagccccccaaaggccagcgcagtggtgaaggattgtgtcagggcttgtctg
gattccacgtacaagtatatcttcgacaactgccacgaactctattctcagctgatagac
ccgagcaagaagcaggatgttcctcgggaagagcagggaccaaccaccaagaacctggac
ttctggccacagttgattacactgatggtcactatcattgatgaggataagactgcctac
acccctgttctcaatcagttcccacaagaactaaacatggggaagataagtgcagaaatc
atgtggtctctctttgctctcgatatgaaatatgctctagaggaacatgagaagcagcgc
ttatgcaagagcaccgattatatgaatttgcatttcaaagtgaaatggttttataatgag
tatgtacgagaacttcctgccttcaaggatgctgttccagaatattccctgtggtttgag
ccttttgttatgcaatggctagatgaaaatgaagatgtgtccatggaattccttcatgga
gcactgggaagagacaaaaaggatggattccagcagacatcggaccatgccctcttctcc
tgttctgtggttgatgtctttgctcagcttaaccagagctttgagatcattaagaaactg
gaatgccccaatcctgaagccttatcacacttaatgagacgattcgcaaagaccatcaat
aaggttctggtccaatacgctgcgatcgtatcaagtgacttcagttcatactgtgataag
gagacagtgccttgcatattgatgaacaacatccaacaactgcgggtccagctggaaaag
atgttcgaatccatgggtgggaaagagctagaccccgaagctagcactattctgaaagaa
cttcaaatcaaactcaacggggttctggatgcgctcagcgtcacttatggagaaagtttc
caacttgtaattgaagagtgcataaagcagatgggtgccgagctaaatcagatgcgagca
aacggaaacagcgcagccaataagaacaacgcagcgatggatgcggagattgtgctgagg
ccgctcatggacttcttggataagatattaagtctttcagcaaaaatctgtgagaaaacg
gtcctgaagcgagttctgaaggagctctggaaattagttcttaacaagatagagaaacag
attgttctccctccactgacagaccagacaggacctcagatgatcttcattgcagctaaa
gagcttggacagttatccaaactgaaggagcacatgatccgagatgatgccaagggtctg
acaccaagacaatgtgcaataatggaggtggtcctggccactataaagcaatactttcat
gcaggaggaaatggcctgaagaagaattttctggagaaaagcccagatcttcattccctg
agatacgctctcagcctctacacacaaaccactgatgctttgatcaagaagttcatcgag
acccagggctcacagagtcgttcctccaaagatgctgtaggccagatctctgtccatgtg
gatgtcaccaccaccccagggactggagagcataaagtcactgtaaaagtgattgcgatc
aatgacctaaactggcagaccaccaccatgttccgcccctttgtggaagtgtgcatgctg
ggacccagcctgggagacaagaagagaaaacaagggacaaagacaaaaagtaacacgtgg
tcaccgaagtacaatgaaaccttccagttcattctgggtaatgagaaccgcccaggagcc
tatgaacttcacctctcagttaaggactactgctttgcccgagaagatcgaataattgga
atgacagtcattcagttacagaatatagcagagaaagggagctacggggcatggtaccct
ctcctgaaaaatctctctatggatgaaactggtttaaccatccttcgaatactctctcag
agaaccagtgacgatgtcgctaaagagtttgtgagacttaagtctgaaacgaggtctatt
gacgagagtgcctga

DBGET integrated database retrieval system