KEGG   Rattus norvegicus (rat): 286953Help
Entry
286953            CDS       T01003                                 

Gene name
Cyp2b3, Cyp2b6
Definition
cytochrome P450, family 2, subfamily b, polypeptide 3 (EC:1.14.14.1)
Orthology
K07412  
cytochrome P450, family 2, subfamily B [EC:1.14.14.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Retinol metabolism
Metabolic pathways
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    286953 (Cyp2b3)
   00590 Arachidonic acid metabolism
    286953 (Cyp2b3)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    286953 (Cyp2b3)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    286953 (Cyp2b3)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     286953 (Cyp2b3)
Cytochrome P450 [BR:rno00199]
 Cytochrome P450, animal type
  CYP2 family
   286953 (Cyp2b3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q21
AA seq 491 aa AA seqDB search
MDTSVLLLLAVLLSFLLFLVRGHAKVHGHLPPGPRPLPLLGNLLQMDRGGFRKSFIQLQE
KHGDVFTVYFGPRPVVMLCGTQTIREALVDHAEAFSGRGIIAVLQPIMQEYGVSFVNEER
WKILRRLFVATMRDFGIGKQSVEDQIKEEAKCLVEELKNHQGVSLDPTFLFQCVTGNIIC
SIVFGERFDYRDRQFLRLLDLLYRTFSLISSFSSQMFEVYSDFLKYFPGVHREIYKNLKE
VLDYIDHSVENHRATLDPNAPRDFIDTFLLHMEKEKLNHYTEFHHWNLMISVLFLFLAGT
ESTSNTLCYGFLLMLKYPHVAEKVQKEIDQVIGSQRVPTLDDRSKMPYTEAVIHEIQRFS
DVSPMGLPCRITKDTLFRGYLLPKNTEVYFILSSALHDPQYFEQPDTFNPEHFLDANGAL
KKCEAFMPFSIGKRMCLGEGIARSELFLFFTTILQNYSVSSPVDPNTIDMTPKESGLAKV
APVYKICFVAR
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggatactagtgtccttctcctccttgctgtcctcctcagcttcttgctattcctggtc
agaggccatgcaaaagttcatggtcatcttccaccaggaccccgtcccttacccctcttg
ggaaacctcttgcagatggacagaggaggctttcgtaagtctttcattcagcttcaagaa
aaacacggagatgtgttcacagtatactttggacctaggcctgtggtcatgctgtgtggg
acacagaccataagggaggctctggtggaccatgctgaggctttctctggccggggaata
attgctgtgcttcagccaattatgcaggaatacggtgtgtcctttgttaatgaagaaagg
tggaagatccttcggcgattatttgtagccaccatgagagactttgggataggaaagcag
agtgtggaggatcagataaaggaggaggccaaatgtttagtggaggaactgaagaatcat
cagggagtctccctggacccaacgttcctcttccagtgcgtcacaggcaacataatctgc
tccattgtctttggagagcgctttgactacagagaccgccagttcctgcgcttgctcgac
ctgttgtataggaccttttccctcataagctcattctccagccagatgtttgaggtctac
tctgacttcctgaagtactttcctggtgtccacagagaaatctacaaaaacctgaaggaa
gtcctcgactacattgatcatagtgtggagaaccacagggccactttggaccccaatgct
ccccgagactttatcgatactttccttctgcacatggagaaggagaagttgaaccactac
acggagttccatcattggaacctaatgatatctgtgctctttcttttccttgctggcact
gagtctacaagcaacactctctgctatggattcctgctcatgctcaagtaccctcatgtt
gcagagaaagtccaaaaggagattgatcaggtgatcggctcacagcgggtcccaaccctt
gatgaccgctccaaaatgccatacactgaggcagtcatccatgagattcagagattttct
gatgtttctccaatgggtttgccatgcagaatcaccaaagacacattgttccgagggtac
ctgctccccaagaacactgaggtgtacttcatcctgagttcagctctccatgacccacag
tactttgaacaaccagacaccttcaatcctgagcacttcctggatgccaatggggcactg
aagaaatgtgaagctttcatgcccttctccataggaaagcgtatgtgtcttggagaaggc
attgcccgaagtgaattgttccttttcttcactaccatcctccagaactactcagtgtcc
agccctgtggatcctaacaccattgatatgactcccaaggagagtggattagccaaagta
gccccagtgtacaagatttgctttgtagcccgctga

DBGET integrated database retrieval system