KEGG   Rattus norvegicus (rat): 286989Help
Entry
286989            CDS       T01003                                 

Gene name
Ugt2b7, UDPGT_2B7, Ugt2b8
Definition
UDP glucuronosyltransferase 2 family, polypeptide B7 (EC:2.4.1.17)
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
rno  Rattus norvegicus (rat)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    286989 (Ugt2b7)
   00053 Ascorbate and aldarate metabolism
    286989 (Ugt2b7)
   00500 Starch and sucrose metabolism
    286989 (Ugt2b7)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    286989 (Ugt2b7)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    286989 (Ugt2b7)
   00860 Porphyrin and chlorophyll metabolism
    286989 (Ugt2b7)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    286989 (Ugt2b7)
   00982 Drug metabolism - cytochrome P450
    286989 (Ugt2b7)
   00983 Drug metabolism - other enzymes
    286989 (Ugt2b7)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    286989 (Ugt2b7)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     286989 (Ugt2b7)
Glycosyltransferases [BR:rno01003]
 Others
  Hydrophobic molecule
   286989 (Ugt2b7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
14p21
AA seq 530 aa AA seqDB search
MPQKWISALLLLQISFCFRSGNCGKVLVWPLEYSHWMNLKIILDELVQRGHEVTVLRPSS
SVSLDPKKASGLVYETSPTTSNNDEVEKSFYPVGDMWTYDVPKYTCLRYYPSLNKMFGQF
SDLWLQLCREVVSNKELIAKLKESQFDVVLSDAVGPCGELIAEILQLPFVYSLRFATAPG
IEKYSAGQPFPPSYVPIILSGFSGQMTFMERVENMLCLLYFDSWFESFPAKDWDPFFSEI
LGRPTTMVDTMKKAEIWLIRSYWDLEFPRPSLPNIEFVGGLHCQPAKPLPKEMEDFAQSS
GEHGVWVFSLGSMIRNITQERANTIASALAQIPQKVFWRFEGKKPDTLGPNTRVFKWIPQ
NDLLGHPKTKAFVTHGGANGIYESIHYGIPPMVGIPLFAEQRDNVAHMVAKGAAVSIDFH
TMSSSDLLNALKAVINNPSYKKKVMWLSAIHHDQPLKPLDRAVFWIEFVMRHKGAKHLRP
LAHNLALVSVHSLDVIGFLLACVLAIVLLAVKCCLFLYRFFVKVAKNKRD
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgcctcagaagtggatttctgctctgctcctactgcagataagtttctgcttcagatct
gggaactgtgggaaagtgttggtgtggccattggaatacagtcactggatgaatttaaag
ataatactggatgaacttgtacagaggggacatgaagtcactgttctcagaccttcatct
tccgtctctcttgatcccaaaaaagcatctggtcttgtatatgaaacatctcctacaact
tccaataatgatgaagtagaaaagtctttttacccagtgggtgatatgtggacatacgat
gtgccaaaatatacatgtttgagatactacccatctttgaacaaaatgttcgggcaattt
tctgatttgtggttacagctttgtagagaagttgtttcaaacaaggaacttatagcaaaa
ctaaaggaatcccagtttgatgtggttctttcagatgctgttggtccctgtggtgagctg
atagctgagatactgcagttaccatttgtgtacagtcttcgctttgccaccgcccctgga
atagaaaagtacagtgcaggacaacccttccctccctcttatgtacctattattttgtca
ggatttagtggtcaaatgacattcatggagagagtggaaaatatgctatgtttactttat
tttgattcctggttcgagtcatttcctgctaaggattgggatccatttttcagcgaaatt
ttaggaagacccactacaatggttgacacaatgaagaaagcagaaatatggctcattcgg
tcctactgggacttggagtttccccgcccatccttgccaaacattgagtttgttggagga
cttcactgccaacctgccaaaccattacctaaggaaatggaagactttgcacagagctca
ggagaacatggtgtgtgggtgttttctctggggtcgatgatcaggaacataacacaagaa
agggctaacacaattgcatcagccctggcacaaattccacaaaaggttttttggagattt
gagggcaagaaaccagacaccttaggacccaatactcgggtgttcaagtggataccccag
aatgaccttcttggtcatccaaaaactaaggcttttgtaactcatggtggagccaatggc
atctatgagtcaatccattatgggatcccccccatggttggcatccctttatttgcagaa
caacgtgataacgttgctcacatggtagccaaaggagcagctgtttctatagattttcat
acaatgtccagttcagatttgctcaacgcactgaaggcagtcatcaataacccctcctat
aaaaagaaagtgatgtggttgtcagccattcaccatgaccagcctctgaagcctctggac
agagcagtcttctggattgagtttgtcatgcgtcacaaaggggccaagcatctgagacca
cttgcacataaccttgccctggtatcagtacactctctggatgtgattggattcctgctt
gcctgtgtgctggccattgttttacttgctgtaaaatgctgtctgtttctttaccgattt
tttgtaaaggtggcaaagaataaaagggactag

DBGET integrated database retrieval system