KEGG   Rattus norvegicus (rat): 286997Help
Entry
286997            CDS       T01003                                 

Gene name
Mapk15, Erk7
Definition
mitogen-activated protein kinase 15 (EC:2.7.11.24)
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     286997 (Mapk15)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [Table]
   286997 (Mapk15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
7q34
AA seq 547 aa AA seqDB search
MCAAEVDRHVSQRYLIKRRLGKGAYGIVWKAMDRRTGEVVAIKKIFDAFRDQTDAQRTFR
EIMLLREFGGHPNIIRLLDVIPAKNDRDIYLVFESMDTDLNAVIQKGRLLEDIHKRCIFY
QLLRATKFIHSGRVIHRDQKPANVLLDAACRVKLCDFGLARSLSDFPEGPGGQALTEYVA
TRWYRAPEVLLSSRWYTPGVDMWSLGCILGEMLRGQPLFPGTSTFHQLELILETIPLPSM
EELQGLGSDYSALILQNLGSRPRQTLDALLPPDTPPEALDLLKRLLAFAPDKRLSAEQAL
QHPYVQRFHCPDREWTRGSDVRLPVHEGDQLSAPEYRNRLYQMILERRRNSRSPREEDLG
VVASRAELRASQRQSLKPGVLPQVLAETPARKRGPKPQNGHGHDPEHVEVRRQSSDPLYQ
LPPPGSGERPPGATGEPPSAPSGVKTHVRAVAPSLTSQAAAQAANQPLIRSDPARGGGPR
AVGARRVPSRLPREAPEPRPGRRMFGISVSQGAQGAARAALGGYSQAYGTVCRSALGRLP
LLPGPRA
NT seq 1644 nt NT seq  +upstreamnt  +downstreamnt
atgtgtgctgccgaggtggaccgtcatgtatcccagagatacctgatcaagcggaggctt
gggaagggggcctacggcattgtatggaaggccatggaccggaggactggtgaggtagtg
gccatcaagaaaatctttgatgcctttagggaccagacagatgctcagaggaccttccgt
gaaatcatgcttctccgggagtttgggggccatcccaacatcatccgcctgcttgatgta
atcccagcaaagaatgacagggatatttacctggtgtttgagtccatggacaccgacctg
aacgcggtcatccagaagggcagactgttggaggacatccacaaacgttgcatcttttac
cagctcctgagagccaccaagtttatccattcagggcgcgtcattcaccgggaccagaag
ccagccaacgttctattggatgctgcttgccgggtgaaactatgtgactttggcctggca
cgctccctcagtgacttccctgaagggcctgggggccaggccctgacagaatatgtggcc
acacgctggtaccgagctccagaggtgcttctgtcttcccgatggtatacccctggggtg
gacatgtggagcctgggctgcatactgggagagatgcttcgagggcagccactgtttccg
ggtacatctactttccaccagctggagctgatcctggagaccattccattgccctccatg
gaggagctccagggccttggatcagactacagtgctttgattctgcagaatcttggatcc
aggccacggcagacgctggacgccctcctgccgccagacacccccccagaagccctggac
ctcctcaagcgactcttggcatttgctccggacaaacggcttagtgcagagcaggctctt
caacacccttacgtgcagagattccattgccccgaccgcgagtggacacgggggtccgat
gtgcggctcccggtacacgaaggagaccagctctctgcaccagagtatcgcaaccgcctg
taccagatgatcctggagcggagacggaacagccgcagccctcgagaggaagacttgggg
gttgtggcctcgcgggcagagctcagggcttcccagaggcaatcgctcaagcccggagtc
ctcccccaggtcttggcggagacgcctgcgcggaaacgcggacccaaacctcagaatggc
catggtcacgatcccgagcatgtggaagttcgcaggcagagttcagaccccctgtaccaa
cttccgccgccaggcagcggggaaaggcccccaggggccacaggggagccaccctccgca
ccctcaggggtgaagactcacgttagggcggtggcgccctccctgacttcacaggccgcg
gctcaggcggccaatcagcctctgatccgcagtgatccggcccggggcggtgggccaagg
gctgtcggcgcgcgacgggtcccttcccgcctgccccgggaggccccggaaccccgaccc
ggccgaaggatgtttggcatctcggtctcgcagggggcccagggtgcagccagagctgct
cttggcggctactcccaggcctacgggaccgtgtgccgctccgcgctgggccgcctgcct
ctgctccccggaccgcgtgcgtga

DBGET integrated database retrieval system