KEGG   Rattus norvegicus (rat): 287164Help
Entry
287164            CDS       T01003                                 

Gene name
Pdia2, Pdip
Definition
protein disulfide isomerase family A, member 2 (EC:5.3.4.1)
Orthology
K09581  
protein disulfide isomerase family A, member 2 [EC:5.3.4.1]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     287164 (Pdia2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q12
AA seq 527 aa AA seqDB search
MDDRFLPVLLLLLGVSGSWGQGEEPGGPPEVLSEESIGEEVPEEDGILVLNNQTLSLALQ
EHSALMVEFYAPWCGHCKALAPEYSKAAALLAAESAAVTLAKVDGPAEPELTKEFGVVGY
PTLKFFQNGNRTNPEEYIGPKTAEGIAEWLRRRVGPSATRLEDEEGVQALMAKWDMVVIG
FFQDLQEEDVATFLALARDALDMAFGFTDQPQLFEKFGLTKDTVVLFKKFDEGRADFPVD
KEAGLDLGDLSRFLITHSMHLVTEFNSQTSPKIFAARILNHLLLFVNQTLAQHRELLTGF
REAAPPFRGQVLFVMVDVAADNSHVLNYFGLKAEEAPTLRLINVETTKKYAPAGVIPITA
ASVAAFCQAVLHGEVKHYLLSQEIPPDWDQRPVKTLVSKNFEQVAFDETKNVFVKFYAPW
CSHCKEMAPAWEALAEKYRDREDIVIAEMDATANELEAFSVHGYPTLKFFPAGPDRKIIE
YKSTRDLETFSKFLDRGGDLPEEESKEPAVSAPEAQPNSTLGPKEEL
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggatgatcggtttctgccagtgttgctgctcctgctgggtgtctcaggctcatgggga
cagggagaggagccggggggtcccccagaggtgctctctgaggagtccattggggaagaa
gtccccgaggaggatggaatcttggttttgaacaaccaaaccctgagcctggcactgcag
gagcattcagccctgatggtggagttttatgccccatggtgtggtcactgcaaggcacta
gctcctgagtacagcaaggcagctgccctgctggcagctgagtcagctgcggtcaccttg
gccaaggtggatgggcctgcggaaccagagctgaccaaggagtttggagtggtagggtac
cctacactcaagttcttccagaatggaaaccgcacaaacccagaagaatacatagggccc
aagacagctgagggcattgctgagtggctgaggcggcgagtggggcccagcgccacacgt
ctggaggatgaggaaggtgtccaggcactgatggccaaatgggatatggtggtcattggc
ttctttcaggatctacaggaagaggatgtggcaactttcctggccttggccagggatgct
ctggacatggcctttggcttcactgaccagccacagctttttgagaagtttggcctcacc
aaggacactgtggtccttttcaagaagtttgatgagggtcgggccgacttcccggtagac
aaggaggctggcctggacctgggggacctgtcccgcttcctcatcacacacagcatgcac
ctggtcacagaattcaacagccagacatcacctaagatctttgcagccaggatcctcaac
cacctgctgctgtttgtgaaccagacactagctcagcacagggagctactgacaggcttc
agggaggcagctcctccattccggggacaggtgttgtttgtgatggtggatgtggccgct
gacaacagccatgtgctaaattattttggcctcaaggctgaggaagcccccaccctgcgt
ctgattaatgttgagactaccaagaagtatgcacctgcaggggtgatacccatcactgca
gcttctgtggctgcattctgccaggcagtcctccatggggaagtcaagcactatctcctg
agccaggagataccccccgactgggaccagcggccagtcaagactcttgtgagcaagaat
tttgagcaggttgcctttgatgaaaccaagaatgtgtttgtcaagttctatgccccatgg
tgcagccactgcaaggagatggctccagcctgggaggcactggcagagaagtacagggat
cgtgaggacattgtcattgctgagatggatgctacagctaacgagctggaggccttctct
gtgcatggctatcccactctcaagttcttccctgcaggacctgaccgaaagattatagaa
tacaaaagcaccagggacctagagacattctccaagttcctggacagaggaggtgacctg
cctgaggaagaatccaaggagcctgcagtctctgccccagaagcacaacccaattccacc
ttgggtcccaaggaggagctgtag

DBGET integrated database retrieval system