KEGG   Rattus norvegicus (rat): 287269Help
Entry
287269            CDS       T01003                                 

Gene name
Clk4
Definition
CDC-like kinase 4 (EC:2.7.12.1)
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     287269 (Clk4)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   287269 (Clk4)
Spliceosome [BR:rno03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    287269 (Clk4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q22
AA seq 301 aa AA seqDB search
MDGLHVAVKIVKNVGRYREAARSEIQVLEHLNSTDPNSVFRCVQMLEWFDHHGHVCIVFE
LLGLSTYDFIKENSFLPFQIDHIRQMAYQICQSINFLHHNKLTHTDLKPENILFVKSDYV
VKYNSKMKRDERTLKNTDIKVVDFGSATYDDEHHSTLVSTRHYRAPEVILALGWSQPCDV
WSIGCILIEYYLGFTVFQTHDSKEHLAMMERILGPIPAHMIQKTRKRKYFHHNQLDWDEH
SSAGRYVRRRCKPLKEFMLCHDEEHEKLFDLVRRMLEYDPTKRITLDEALQHPFFDLLKG
K
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggatggcttacatgtggcagtgaaaattgtaaaaaatgtaggccgttaccgggaggca
gctcgctctgaaatccaagtgctggagcacttgaacagcactgaccccaatagtgtcttc
cgatgtgtccagatgctagaatggtttgatcatcatggtcatgtttgtattgtgtttgag
ctgctgggccttagtacctatgattttattaaagaaaacagctttctgccatttcaaatt
gatcacatcaggcaaatggcttatcagatctgccaatctataaattttttacatcataat
aaattaacacacacggatctaaaacctgaaaatattttatttgtaaagtctgactatgtg
gtcaaatacaattctaaaatgaaacgagatgagcgcacgttgaaaaacacagatatcaaa
gttgttgactttggaagtgcgacatatgacgatgaacatcatagtactttggtgtccaca
agacactacagggctccagaggtcattttggctttaggttggtctcagccttgtgatgtt
tggagcataggctgcattcttattgagtattaccttggattcacagtctttcagactcat
gatagtaaagaacacctggcaatgatggagcggatactcgggcccatcccagcacacatg
atccaaaagacaaggaaacgcaagtatttccaccataaccagctagattgggatgagcat
agttcagctgggagatacgttaggagacgctgcaagccgttaaaggaatttatgctgtgt
cacgatgaagagcatgagaagctgtttgacctggttcgaagaatgttggagtatgaccca
acaaaaaggattaccttggatgaagctttgcagcaccctttctttgacttattaaaaggg
aaatga

DBGET integrated database retrieval system