KEGG   Rattus norvegicus (rat): 287454Help
Entry
287454            CDS       T01003                                 

Gene name
Alox12, 12-LO, 12S-LOX
Definition
(RefSeq) arachidonate 12-lipoxygenase, 12S type
  KO
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
rno  Rattus norvegicus (rat)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Antifolate resistance
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    287454 (Alox12)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    287454 (Alox12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    287454 (Alox12)
 Human Diseases
  Drug resistance
   01523 Antifolate resistance
    287454 (Alox12)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     287454 (Alox12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
Position
10q24
AA seq 663 aa AA seqDB search
MGRYRVRVVTGPWLFSGSVNLVRLWLVGAHREARLELQLRPARGKEEEFDFDVAEDLGPL
QFVKLHKEHTVVDDAWFCNLITVQGPGMSAEAVFPCYRWVQGEGILRLPEGTARLAGDNA
LDVFQKHREKELKERQQTYRWATWKQGLPQTIAADCKDDLPPNMRFHEEKRLDFEWTLKA
GVLEMGLKRVYTLLRSWNRLEDFDQIFWGQKSALAEKVHRCWQEDELFGYQFLNGANPML
LRRSTSLPSRLVLPPGTEELQAQLEKELKDGCLFEADFILLDGIPANVIRGEQQYLAAPL
VMLRMDPSGKLLPMAIQIQPPNPSSPAPTLFLPSDPPLAWLLAKIWVRNSDFQLQELQFH
LLNTHLVAEVIAVATMRCLPGLHPIFKLLVPHIRYTMEINTRSRTQLISDGGIFDQVVST
GGGGHVQLLTRAVAQLTYCSLCPPDDLATRGLLRVPSALYAQDALQLWEVTARYVNGMVH
LFYQSDDIVRGDPELQAWCREITEVGLCHAQDRGFPVSFQSRAQLCHFLTMCVFTCTSQH
AAINQGQLDWYGWVPNAPCTMRMPPPTSKDDVTMETIMGSLPDVQKSCLQMTITWHLGRL
QPDMVPLGHHKEKYFSDPRTKAVLSQFQADLENLEKEITARNQQLDLPYEYLKPSRIENS
ITI
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgggccgctaccgcgtccgcgtggtcactgggccctggctcttctcgggatccgtcaac
ctggtgcgtctgtggctggtcggggcgcacagggaggcgaggctggagctgcagctgcgg
ccagcgcggggcaaggaggaggagtttgatttcgatgttgccgaggacttggggccactg
cagttcgtgaaactgcacaaagagcacacagttgtggacgacgcctggttctgcaacctc
atcacagttcaggggcccgggatgagcgcagaggccgtcttcccctgctaccgctgggtg
cagggagaaggaatcctgagactgccggaggggacagcccgtctggcaggagacaatgcc
ttggatgtcttccagaagcatcgagagaaggaactgaaggaaagacaacagacctaccgc
tgggccacctggaagcaaggcttacctcagacaatagcagcagactgtaaggatgacctc
cctccaaacatgagattccatgaggagaagagactggactttgaatggacgctgaaggcg
ggggttctggaaatgggcctcaaacgtgtttataccctcctgagaagctggaaccgtctg
gaagactttgatcagatcttctggggccagaagagtgccttggctgagaaggttcaccgg
tgttggcaggaagatgagctctttggctaccagtttctcaatggcgccaaccccatgctg
ttgagacgctccacctctctgccctccagactggtactgccccctgggacagaggagctt
caagcgcagctggagaaagaactcaaggatggatgcctgtttgaggctgactttatcctg
ctggatggaattccagctaatgtgatccgaggagaacagcagtacctggctgcccctctt
gtcatgttgaggatggaccccagtgggaagctgctccccatggctatccagattcagcct
cccaatcccagctccccagctccaacattgttcctgccctcagatcctccacttgcctgg
ctcttggctaagatctgggtccgaaattcagatttccaactgcaggagctccaattccat
ttgctgaacactcatctggtggctgaggtcattgctgttgccaccatgaggtgcctccca
ggactacaccctatctttaagctcctagttccgcacatccgttacactatggaaattaac
acacggagccggacccagctcatctcagatggagggatatttgatcaggtagtgagcaca
ggtggaggcggccatgttcagttgctcactcgggcagtggctcagctgacgtactgctcc
ctctgtcctcccgatgatctggctacccgaggcctgctgagagtcccaagtgccctctac
gctcaggatgctttgcagctctgggaggtcactgccaggtatgtgaacgggatggtccat
ctcttctaccagagtgacgatattgtgaggggagacccagagctgcaggcctggtgtcgg
gagatcactgaggtggggctgtgccatgcccaggacagaggattccctgtctccttccag
tcccgggcacagctctgccatttccttaccatgtgtgttttcacatgtacttcccagcat
gctgccatcaaccagggccagctggactggtacggttgggtacctaatgctccatgcaca
atgaggatgcctccaccaaccagcaaggacgatgtgacgatggagaccatcatgggctca
ctccctgatgttcagaagtcctgtctgcagatgaccatcacatggcacctgggccgcctc
cagccagacatggtacctctaggacaccacaaagaaaagtatttctcagacccaaggacc
aaagctgtgctcagccaatttcaagcagatctggaaaatttggagaaagagattacagcc
cggaaccagcagcttgacctgccctacgaatacctcaagcctagccgtatagagaacagc
atcaccatctga

DBGET integrated database retrieval system