KEGG   Rattus norvegicus (rat): 287454Help
Entry
287454            CDS       T01003                                 

Gene name
Alox12, 12-LO, 12S-LOX
Definition
arachidonate 12-lipoxygenase (EC:1.13.11.31)
Orthology
K00458  
arachidonate 12-lipoxygenase [EC:1.13.11.31]
Organism
rno  Rattus norvegicus (rat)
Pathway
Arachidonic acid metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    287454 (Alox12)
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    287454 (Alox12)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    287454 (Alox12)
Enzymes [BR:rno01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.31  arachidonate 12-lipoxygenase
     287454 (Alox12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Position
10q24
AA seq 663 aa AA seqDB search
MGRYRVRVVTGPWLFSGSVNLVRLWLVGAHREARLELQLRPARGKEEEFDFDVAEDLGPL
QFVKLHKEHTVVDDAWFCNLITVQGPGMSAEAVFPCYRWVQGEGILRLPEGTARLAGDNA
LDVFQKHREKELKERQQTYRWATWKQGLPQTIAADCKDDLPPNMRFHEEKRLDFEWTLKA
GVLEMGLKRVYTLLRSWNRLEDFDQIFWGQKSALAEKVHRCWQEDELFGYQFLNGANPML
LRRSTSLPSRLVLPPGTEELQAQLEKELKDGCLFEADFILLDGIPANVIRGEQQYLAAPL
VMLRMDPSGKLLPMAIQIQPPNPSSPAPTLFLPSDPPLAWLLAKIWVRNSDFQLQELQFH
LLNTHLVAEVIAVATMRCLPGLHPIFKLLVPHIRYTMEINTRSRTQLISDGGIFDQVVST
GGGGHVQLLTRAVAQLTYCSLCPPDDLATRGLLRVPSALYAQDALQLWEVTARYVNGMVH
LFYQSDDIVRGDPELQAWCREITEVGLCHAQDRGFPVSFQSRAQLCHFLTMCVFTCTSQH
AAINQGQLDWYGWVPNAPCTMRMPPPTSKDDVTMETIMGSLPDVQKSCLQMTITWHLGRL
QPDMVPLGHHKEKYFSDPRTKAVLSQFQADLENLEKEITARNQQLDLPYEYLKPSRIENS
ITI
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgggccgctaccgcgtccgcgtggtcactgggccctggctcttctcgggatccgtcaac
ctggtgcgtctgtggctggtcggggcgcacagggaggcgaggctggagctgcagctgcgg
ccagcgcggggcaaggaggaggagtttgatttcgatgttgccgaggacttggggccactg
cagttcgtgaaactgcacaaagagcacacagttgtggacgacgcctggttctgcaacctc
atcacagttcaggggcccgggatgagcgcagaggccgtcttcccctgctaccgctgggtg
cagggagaaggaatcctgagactgccggaggggacagcccgtctggcaggagacaatgcc
ttggatgtcttccagaagcatcgagagaaggaactgaaggaaagacaacagacctaccgc
tgggccacctggaagcaaggcttacctcagacaatagcagcagactgtaaggatgacctc
cctccaaacatgagattccatgaggagaagagactggactttgaatggacgctgaaggcg
ggggttctggaaatgggcctcaaacgtgtttataccctcctgagaagctggaaccgtctg
gaagactttgatcagatcttctggggccagaagagtgccttggctgagaaggttcaccgg
tgttggcaggaagatgagctctttggctaccagtttctcaatggcgccaaccccatgctg
ttgagacgctccacctctctgccctccagactggtactgccccctgggacagaggagctt
caagcgcagctggagaaagaactcaaggatggatgcctgtttgaggctgactttatcctg
ctggatggaattccagctaatgtgatccgaggagaacagcagtacctggctgcccctctt
gtcatgttgaggatggaccccagtgggaagctgctccccatggctatccagattcagcct
cccaatcccagctccccagctccaacattgttcctgccctcagatcctccacttgcctgg
ctcttggctaagatctgggtccgaaattcagatttccaactgcaggagctccaattccat
ttgctgaacactcatctggtggctgaggtcattgctgttgccaccatgaggtgcctccca
ggactacaccctatctttaagctcctagttccgcacatccgttacactatggaaattaac
acacggagccggacccagctcatctcagatggagggatatttgatcaggtagtgagcaca
ggtggaggcggccatgttcagttgctcactcgggcagtggctcagctgacgtactgctcc
ctctgtcctcccgatgatctggctacccgaggcctgctgagagtcccaagtgccctctac
gctcaggatgctttgcagctctgggaggtcactgccaggtatgtgaacgggatggtccat
ctcttctaccagagtgacgatattgtgaggggagacccagagctgcaggcctggtgtcgg
gagatcactgaggtggggctgtgccatgcccaggacagaggattccctgtctccttccag
tcccgggcacagctctgccatttccttaccatgtgtgttttcacatgtacttcccagcat
gctgccatcaaccagggccagctggactggtacggttgggtacctaatgctccatgcaca
atgaggatgcctccaccaaccagcaaggacgatgtgacgatggagaccatcatgggctca
ctccctgatgttcagaagtcctgtctgcagatgaccatcacatggcacctgggccgcctc
cagccagacatggtacctctaggacaccacaaagaaaagtatttctcagacccaaggacc
aaagctgtgctcagccaatttcaagcagatctggaaaatttggagaaagagattacagcc
cggaaccagcagcttgacctgccctacgaatacctcaagcctagccgtatagagaacagc
atcaccatctga

DBGET integrated database retrieval system