KEGG   Rattus norvegicus (rat): 287473Help
Entry
287473            CDS       T01003                                 

Gene name
Nek8
Definition
(RefSeq) NIMA-related kinase 8 (EC:2.7.11.1)
  KO
K20877  
NIMA (never in mitosis gene a)-related kinase 8 [EC:2.7.11.1]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     287473 (Nek8)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: Other group
  NEK family
   287473 (Nek8)
Chromosome [BR:rno03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Other cilium assembly proteins
    287473 (Nek8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q25
AA seq 698 aa AA seqDB search
MEKYERIRVVGRGAFGIVHLCLRKADQKLVIIKQIPVEQMTKEERQAAQNECQVLKLLNH
PNVIEYYENFLEDKALMIAMEYAPGGTLAEFIQKRCNSLLEEETILHFFVQILLALHHVH
THLILHRDLKTQNILLDKHRMVVKIGDFGISKILSSKSKAYTVVGTPCYISPELCEGKPY
NQKSDIWALGCVLYELASLKRAFEAANLPALVLKIMSGTFAPISDRYSPELRQLVLSLLS
LEPAQRPPLSHIMAQPLCIRALLNIHTDVGSVRMRRAEKCLTPGTPMAPGSTGSRATSAR
CRGVPRGPVRPAIPPPLSSVYAWGGGLSIPLRLPMPNTEVVQVAAGRTQKAGVTRSGRLI
LWEAPPLGTGGGTLLPGAVELPQPQFVSRFLEGQSGVTIKHVACGDLFTACLTDRGIIMT
FGSGSNGCLGHGSLTDISQPTIVEALLGYEMVQVACGASHVLALSADGELFAWGRGDGGR
LGLGTRESHNCPQQVPMVPGQEAQRVVCGIDCSMILTSPGRVLACGSNRFNKLGLDCLSL
EEEPVPHQQVEEALSFTPLGSAPLDRETLLCVDLGTAHSAAVTASGACYTFGSNQHGQLG
TSSRRVSRAPCRVQGLEGIKMVMVACGDAFTVAIGAEGEVYSWGKGARGRLGRRDEDAGL
PRPVQLDETHPYTVTSVSCCHGNTLLAVRSVTDEPVPP
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggagaagtacgagcggatccgagtggtgggaagaggtgccttcgggattgtgcacctg
tgccttcgaaaggctgaccagaagctggtgatcatcaagcagatcccagtggaacagatg
accaaagaggagaggcaggcggcacagaatgagtgccaggtgctcaaactgctcaaccac
cccaacgtcattgagtactacgagaacttcctggaggacaaggccctcatgatcgccatg
gaatatgcaccaggtggcaccctggctgagttcatccagaagcgctgcaactccctgctg
gaggaggagacgatccttcacttctttgtgcagatcctgcttgcgctgcatcatgtgcac
acacacctcatcctgcatcgggacctcaagacccagaacatccttcttgacaagcaccgc
atggtcgtcaagatcggggactttggcatctctaagatccttagcagcaagagcaaggcc
tacacggtggtgggtactccatgctacatctcccctgagctatgtgagggcaagccctac
aaccagaagagtgacatctgggctctgggctgtgtcttatatgagcttgccagtctcaag
agggcctttgaggcagcgaacttgcccgccctggtgctgaagatcatgagcggcaccttt
gcacccatctctgaccgttatagtcctgagctacgccagcttgtcctgagtctgctcagc
ctggaacctgcacagcggccacccctcagccacatcatggctcagcccctctgcatccgg
gccctactcaacatccacaccgatgtgggcagcgtccgcatgcggagggcagagaagtgc
ctgaccccaggaacacctatggccccgggcagcacagggagcagggccaccagtgcccga
tgcaggggtgtcccccggggacctgtgagaccggccatcccgccgcctctgtcttccgtc
tacgcttggggtggtggccttagcattcccctgaggttgccgatgcccaacacggaggtg
gtccaggtggccgcagggcgcacacagaaggctggcgttacacgctcaggacgcctcatt
ctgtgggaggccccacccctgggaactggaggcggcacactccttccgggggcagtggag
ctgcctcagccccagtttgtctctcgtttcctggagggccagtcaggcgtgaccatcaag
catgtggcctgcggggacctgttcactgcttgcttgacggacagaggcatcatcatgact
tttggcagcggcagcaacgggtgtttaggtcacggcagcctgactgacatcagccagccc
accattgtagaggccctgctggggtatgagatggtgcaggtggcctgtggagcctctcat
gtgctggccctgtccgcagatggagagttatttgcctggggccgaggagatggcggtagg
ctgggactaggcaccagggagtcccataactgccctcagcaggtgcctatggtcccagga
caggaagctcagagagttgtctgtggtattgactgttccatgatcctcacctcaccaggc
agggtcctggcctgtggaagtaacaggttcaacaagctaggcttggactgcctgtccctg
gaggaggagcctgttccccaccagcaagtggaggaggccctgagcttcacgccgctgggt
tctgcacctctggaccgggagaccctgctgtgcgtggaccttggcactgctcattcagct
gctgtgactgcttccggggcctgctatacttttggcagcaatcagcatgggcaattgggc
accagttcccgccgggtcagcagggcaccctgtcgggtccaaggcctagagggcatcaag
atggtgatggtggcctgtggggatgccttcactgtggccattggggcagagggggaagtg
tattcttggggcaaaggagcccggggtcgcctgggaaggagggatgaggatgccggactc
cctagaccagtgcagctggatgagactcatccttacacggtgacatcagtgtcctgctgc
catgggaacactcttttggctgttcgatcagtcacagatgaaccagttcccccctga

DBGET integrated database retrieval system