KEGG   Rattus norvegicus (rat): 287745Help
Entry
287745            CDS       T01003                                 

Gene name
Plcd3
Definition
phospholipase C, delta 3 (EC:3.1.4.11)
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
rno  Rattus norvegicus (rat)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    287745 (Plcd3)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    287745 (Plcd3)
   04070 Phosphatidylinositol signaling system
    287745 (Plcd3)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    287745 (Plcd3)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     287745 (Plcd3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q32.1
AA seq 788 aa AA seqDB search
MLCGGWRRSRRSPEEPRVSAQVAAPLAFLPSPASSDSSTKRPGLRALKKMGLTEDEDVQA
MLRGSKLLKIRSRTWHKERLYRLQEDGLSVWFQRRIPRAASQHIFFVQHIEAVREGHQSE
GLRRFGGAFAPARCLTIAFKGRRKNLDLAAPTAEEAQRWVRGLAKLRARLDAMSQRERLD
HAHTWIHSYLHRADSDQDSKMSFKEIKSLLRMVNVDMNDMYAYRLFKECDHSNNERLEGA
EIEAFLRRLLKRPELEEIFRRYSGEDRVLSASELLEFLEDQGEDGATLACAQKLIQTYEL
NETAKQHELMTLDGFMMYLLSPEGAALNVAHTCVFQDMGQPLAHYFISSSHNTYLTDSQI
GGTSSTEAYIRAFTQGCRCVELDCWEGPGGEPVIYHGHTLTSKILFRDVIQAVRDHAFTL
SPYPVILSLENHCGLEQQIVMARHLRNILGDMLVTQALDSQNPEELPSPEQLKCRVLVKG
KKLPAARNEDGRILSDREDEDEDEEEAEEALETAEQRKRAKQISPELSALVVYCCATRLR
TLEPSPGPPQPCKIGSLSERKARKFTREAGTSFVRHNTQQLTRVYPLGLRMTSANYNPQE
MWNSGCQLVALNFQTPGYEMDLNTGRFLINGQCGYVLKPAYLRQLNTTFDPECPGPPRTT
LTVQVLTAQQLPKLNVEKPNSIVDPLVRVEIYGVPEDCAHKETDYVLNNGFNPCWEQTLQ
FQLRAPELVLVRFVVEDYDTTSPNDFVGQFTLPLNSLKQGYRHIHLLSKDGASLSPATLF
VHIRIENS
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atgctgtgcggtggctggagaaggagccgccgctcgccggaggaaccccgggtgtccgcc
caggtcgcagcgcccctcgcgttcttgccctcgcccgcgtcatccgatagcagcaccaaa
aggcccgggctacgggcactgaagaagatgggcctgacggaggatgaggatgtccaagcc
atgctgcggggctccaagctcctcaagatccgctcacgcacgtggcacaaggagcggctg
taccggctgcaggaggatggcctgagcgtgtggtttcagcggcgcatcccccgcgcagct
tcgcagcacatcttcttcgtgcagcacatcgaggctgtccgggaaggccatcagtcggag
ggcctgcggcggttcgggggcgcctttgcgcctgcgcgctgcctcaccatcgccttcaag
ggccgccgcaagaacctggacctggcagcgcccactgcggaggaagcgcagcgctgggtg
cgagggctggccaagctgagggcgcgcctggatgccatgagccagcgggagcggctagac
cacgcacacacctggatccattcctatctgcaccgggccgactccgaccaagacagcaag
atgagcttcaaggagatcaagagcctgctgaggatggtcaacgtggacatgaatgacatg
tacgcctaccgcctcttcaaggagtgtgaccattctaacaacgagcgtctggaaggggct
gagatcgaggctttcctccggaggctgcttaaacggcccgagctggaggagatcttccgc
cgatactccggcgaggaccgggtactgagtgcctctgagctgctggagttcctggaagac
cagggcgaggacggtgccaccctggcctgtgcccagaagcttatccagacgtatgagctc
aacgagacagccaagcagcacgagctgatgacgctggatggcttcatgatgtatctgttg
tcgcctgagggggctgcgctgaacgtggcccacacgtgtgtgttccaggacatgggtcag
cccctggcccactactttatctcgtcctctcataatacttacctgactgactctcagatc
ggagggaccagcagcaccgaggcctacatcagggcctttacccagggatgccgctgtgtg
gaacttgactgctgggaggggccgggaggggagcccgtcatctaccatgggcataccctt
acttccaagattctctttcgagatgtgatccaagctgtgcgtgaccacgctttcacgctg
tccccatatcctgttatcctgtcccttgagaatcactgcgggttggaacagcagattgtc
atggctcgccaccttcggaacatcctgggagacatgctggtgacacaggccctggactcc
cagaaccccgaggagctgccgtctcctgagcagctcaaatgccgggtcttggtgaagggg
aagaagctgccagctgctcggaatgaggatggtcgaattctgtcagacagggaggatgaa
gatgaagatgaagaggaggcagaagaggctttggagactgcagagcagaggaagcgagcc
aaacagatctccccagagctctcagcgctggttgtgtattgctgtgctacccgcctgcgg
accctggagcctagtcctggtccacctcagccttgcaagattggctccctcagcgagcgc
aaggccaggaagttcaccagggaggcaggaaccagttttgtcaggcacaacactcagcaa
ctgacccgagtgtacccactggggctgcggatgacctcggccaactataacccccaggag
atgtggaactcgggctgtcaactggtggctctgaactttcagactcctggctatgagatg
gacctcaacacggggcgcttcctcataaatgggcagtgcggctatgtcctgaaacccgcc
tacctcaggcaactcaacaccacctttgaccccgagtgccctggaccccccagaactact
ctgacagtccaggtgttaacggcccagcagctgcccaagctgaatgtagagaagcccaac
tccattgtggatcctctggtgcgtgtggagatctacggggtgcctgaagactgtgcgcac
aaggagacggactatgtgctcaataatggcttcaacccctgctgggagcagactctgcag
ttccaactgcgggccccagagctggttctggtgaggtttgtggtagaagactatgatacc
acctcccccaatgattttgtgggacagtttacactgcccctcaacagcctgaagcaaggg
taccgccacatccacttgctgtccaaggatggagcctcgctctctccagccacactcttc
gttcacatccgcattgagaactcttga

DBGET integrated database retrieval system