KEGG   Rattus norvegicus (rat): 287751Help
Entry
287751            CDS       T01003                                 

Gene name
Lyzl6, Lyzb, RGD1306968
Definition
lysozyme-like 6 (EC:3.2.1.17)
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     287751 (Lyzl6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Position
10q32.1
AA seq 149 aa AA seqDB search
MMMRVLFICVVSCLLVVNDGSIINRCTLARILYQEDLDGFEGYSLPHWLCLAFVESKFNI
SKVTENADGTFDYGIFQINSRYWCNDYQSHSENFCRLDCEELLNPNLIPSIHCAKMIVSG
SGGMKNWVDWRLHCLGRPLSYWLTGCRLV
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgagggtgctgtttatctgtgtggtgagctgccttctggtcgtgaatgatggc
agcatcatcaatcgctgtaccttggccaggattctgtatcaagaggacttggatgggttt
gagggctactccctgcctcactggctgtgcttggcttttgtggagagcaaattcaacata
tcaaaggtgactgagaatgcagatggtacctttgactatggaatcttccagatcaatagc
cgttactggtgcaatgactaccagagtcattcagagaacttctgccgcctggactgtgaa
gaactactgaatcccaacctcattccatccatccactgtgcaaaaatgattgtgtctgga
tctggagggatgaagaactgggtagattggaggttgcactgtttaggacggccactctcc
tactggctgacgggatgccgtctggtatga

DBGET integrated database retrieval system