KEGG   Rattus norvegicus (rat): 287871Help
Entry
287871            CDS       T01003                                 

Gene name
Rptor, RGD1311784
Definition
regulatory associated protein of MTOR, complex 1
Orthology
K07204  
regulatory associated protein of mTOR
Organism
rno  Rattus norvegicus (rat)
Pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Insulin signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    287871 (Rptor)
   04152 AMPK signaling pathway
    287871 (Rptor)
   04150 mTOR signaling pathway
    287871 (Rptor)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    287871 (Rptor)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    287871 (Rptor)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q32.3
AA seq 1335 aa AA seqDB search
MESEMLQSPLMGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEAHELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
NCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRSPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
VIVNSYTTGQEACLQGNLIAICLEQLSDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
HEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPMVR
KELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPAATEGGSLTPVRDSPCTPRLRSV
SSYGNIRAVTTARNLNKSLQNLSLTEESGSSVAFSPGNLSTSSSASSTLGSPENEEYILS
FETIDKMRRVSSYSALNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYK
ATVNARPQRILDTSSLTQSAPASPTNKGMHIHQVGGSPPASSTSSCSLTNDVAKQTVSRD
LPSSRPGTAGPTGAQYTPHSHQFPRTRKMFDKGPDQTTDDADDAAGHKSFICATMQTGFC
DWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNTRVRKQAQQVIQKGITRLDDQIFLN
RNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQD
CSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMS
SGDVRIVRIWDTDRETKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALS
ECRVMTYREHTAWVVKAYLQKHPEGHIVSVSVNGDVRFFDPRMPESVNVMQIVKGLTALD
IHPQANLIACGSMNQFTAIYNGNGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGS
NDYYISVYSVEKRVR
NT seq 4008 nt NT seq  +upstreamnt  +downstreamnt
atggagtcggagatgctgcagtcgcctcttatgggactcggggaggaagatgaggcagac
cttacagattggaacttgcctttggcgtttatgaaaaagagacattgtgagaaaattgaa
ggctccaaatctttagcacagagctggagaatgaaggatcggatgaagaccgtcagtgtg
gccttggtcctgtgcctgaatgtgggtgtggatcctccagatgtggtgaagaccacacct
tgtgctcgattggaatgctggattgatcctctgtctatgggtcctcagaaagctctggaa
accatcggtgcaaatctacagaagcagtatgagaactggcagccaagggctcggtacaag
cagagccttgaccccactgtggatgaagtcaagaaactttgcacatctctgcgtcggaac
gccaaggaggaacgggtcctcttccactataatggccatggggtgcccaggcctacggtg
aatggagaggtctgggtcttcaacaagaactacactcagtacatcccactgtccatatat
gacctgcagacgtggatgggcagcccatccatctttgtctacgactgctccaatgctggc
ctcatcgtcaagtccttcaaacagttcgcactgcagagggagcaggaactagaggtagct
gcaattaacccaaaccatccacttgcccagatgcccttgcctccctcaatgaaaaactgc
atccagctggcagcctgtgaggcccacgagctcctgccgatgatccctgacctcccagcc
gacctgttcacatcctgcctcaccactcccatcaagattgctttgcgctggttttgcatg
cagaagtgtgttagtctggtgcctggagtcacactggatttgatagaaaagatccctggc
cggctgaatgaccggagaacccctctgggtgaactgaactggatcttcacagccatcaca
gacaccatcgcctggaatgtgctccctcgggatctctttcaaaagcttttccgacaggac
ctgctggtggcaagtttgtttagaaattttttattggcagaaagaatcatgaggtcgtat
aactgcaccccagtaagcagcccacgacttcccccaacatacatgcatgccatgtggcag
gcctgggaccttgctgtggacatttgcctctctcaactgccaaccatcatcgaagaggga
actgccttcaggcacagcccattctttgctgagcagctgacggcattccaggtgtggctc
accatgggtgtggaaaacaggagcccccccgagcagctgcccatcgtcctacaggtgctg
ctaagccaggtgcaccggctgagagccttggacttgctgggacgatttttggacttgggc
ccttgggcggtgagcttggccctgtcggtgggcatcttcccctatgtactgaagctgctt
cagagctcggcccgagagctgcggccactccttgtcttcatctgggccaaaatcctcgct
gtggacagttcatgccaggctgacctcgtgaaggacaacggtcacaagtacttcctgtcc
gtcttggcagacccatacatgccagctgaacacaggaccatgacagccttcattcttgct
gtaatcgtcaacagctacacaacagggcaagaagcctgcctgcaggggaacctgattgcc
atctgtttggagcagctcagtgacccacaccccttgctacgccagtgggtggccatttgc
ctgggaaggatctggcagaactttgattctgcaaggtggtgtggggtgagagacagcgcc
cacgaaaaactctatagcctcctctccgaccccatccctgaggtacgatgtgcagctgtg
tttgcccttggtacctttgtgggaaactctgctgagaggacagaccactctactaccatt
gaccacaatgtggccatgatgctggctcagctgattaatgatggaagccccatggtccgg
aaggagctggtggtggctctgagtcaccttgtagtccaatatgagagcaatttctgcact
gtggccctgcagttcatggaagaggaaaagaactaccccttgccttctccagcagccaca
gagggagggagcttgactccagttcgagacagcccgtgcacccccagactccggtcagtg
agctcctatgggaacatccgagccgtcaccacagctaggaacctgaacaaatctttgcag
aacctgagcttgacggaagaatcgggcagctcagtggccttctctcccgggaacctcagt
acaagtagtagtgccagcagcaccttgggaagccctgagaacgaggagtatatcctgtcc
ttcgagaccatcgacaagatgcggcgtgtgagctcctattcagcgctcaactccctcata
ggagtctcctttaatagtgtctacactcagatttggagagtcttactgcatttggccgct
gatccctacccagatgtttctgacttagccatgaaagtcctcaacagcattgcttacaag
gccacagtcaacgcccggccccagcgaatcctcgacacatcctctctcacacagtcggcc
ccagccagcccaaccaacaagggcatgcacatccaccaggtgggaggctccccgccagca
tctagcaccagcagctgcagcctgaccaatgatgtggccaagcagacggtcagccgtgac
ctgccctccagccgcccgggtactgccggccccacaggggcacagtacacccctcactcc
caccagttccctcgtacacgaaagatgtttgacaaaggccctgatcagaccacagacgat
gcagatgatgctgccggacacaagagcttcatttgtgccactatgcagacggggttctgt
gactggagtgcccgctactttgcccagccggtcatgaagatccctgaagagcatgaccta
gagagtcagatccgcaaggagcgtgagtggcggttcctgaggaacactcgagtcaggaag
caggcacagcaggtcatccagaagggcatcaccagactggatgatcagatatttctgaac
aggaaccccggcgttccctctgtggtcaaattccacccctttacaccatgcatagctgtt
gctgacaaggacagcatctgtttttgggactgggagaaaggagagaaactggactacttc
cacaatggtaaccctcggtacaccagagtcactgctatggagtacctgaatgggcaggac
tgctccttgctgctgacagccacagacgatggagccatcagggtctggaaaaattttgct
gatttggaaaagaatccagagatggtgactgcgtggcaagggctctcagacatgcttcca
acaacacgaggagctgggatggtggtggactgggaacaagaaactggcctcctcatgagc
tcaggggacgtgcgcattgtccggatctgggataccgaccgggagacgaaggtccaggac
atccccacgggggccgacagctgtgtgacaagtttatcttgtgattcgcaccgctcactc
attgtagctggcctgggtgatggctcgatccgtgtctacgacaggaggatggcactcagt
gaatgccgggtcatgacttaccgagagcacacagcatgggtggtaaaggcctacctgcag
aagcaccctgagggccacatcgtgagtgtgagtgtcaatggagatgtgcgattcttcgat
cctcggatgcctgagtctgtgaatgtaatgcagattgtgaaggggctgacagccctcgac
atccacccccaggcaaacctgatcgcctgtggctccatgaaccagttcacagccatctac
aacggcaatggggagctgatcaacaacatcaaatactacgatggcttcatgggccagcga
gtcggggccatcagctgcctggctttccacccacactggcctcatctggccgtcggaagc
aatgactactacatttctgtatattcggtggagaagcgtgtcagatag

DBGET integrated database retrieval system