KEGG   Rattus norvegicus (rat): 287871Help
Entry
287871            CDS       T01003                                 

Gene name
Rptor, RGD1311784
Definition
regulatory associated protein of MTOR, complex 1
Orthology
K07204  
regulatory associated protein of mTOR
Organism
rno  Rattus norvegicus (rat)
Pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
MicroRNAs in cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:rno04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:rno04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:rno04910]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:rno05206]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
10q32.3
AA seq 1335 aa AA seqDB search
MESEMLQSPLMGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEVWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEAHELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
NCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRSPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
VIVNSYTTGQEACLQGNLIAICLEQLSDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
HEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPMVR
KELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPAATEGGSLTPVRDSPCTPRLRSV
SSYGNIRAVTTARNLNKSLQNLSLTEESGSSVAFSPGNLSTSSSASSTLGSPENEEYILS
FETIDKMRRVSSYSALNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYK
ATVNARPQRILDTSSLTQSAPASPTNKGMHIHQVGGSPPASSTSSCSLTNDVAKQTVSRD
LPSSRPGTAGPTGAQYTPHSHQFPRTRKMFDKGPDQTTDDADDAAGHKSFICATMQTGFC
DWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNTRVRKQAQQVIQKGITRLDDQIFLN
RNPGVPSVVKFHPFTPCIAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQD
CSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMS
SGDVRIVRIWDTDRETKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALS
ECRVMTYREHTAWVVKAYLQKHPEGHIVSVSVNGDVRFFDPRMPESVNVMQIVKGLTALD
IHPQANLIACGSMNQFTAIYNGNGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGS
NDYYISVYSVEKRVR
NT seq 4008 nt NT seq  +upstreamnt  +downstreamnt
atggagtcggagatgctgcagtcgcctcttatgggactcggggaggaagatgaggcagac
cttacagattggaacttgcctttggcgtttatgaaaaagagacattgtgagaaaattgaa
ggctccaaatctttagcacagagctggagaatgaaggatcggatgaagaccgtcagtgtg
gccttggtcctgtgcctgaatgtgggtgtggatcctccagatgtggtgaagaccacacct
tgtgctcgattggaatgctggattgatcctctgtctatgggtcctcagaaagctctggaa
accatcggtgcaaatctacagaagcagtatgagaactggcagccaagggctcggtacaag
cagagccttgaccccactgtggatgaagtcaagaaactttgcacatctctgcgtcggaac
gccaaggaggaacgggtcctcttccactataatggccatggggtgcccaggcctacggtg
aatggagaggtctgggtcttcaacaagaactacactcagtacatcccactgtccatatat
gacctgcagacgtggatgggcagcccatccatctttgtctacgactgctccaatgctggc
ctcatcgtcaagtccttcaaacagttcgcactgcagagggagcaggaactagaggtagct
gcaattaacccaaaccatccacttgcccagatgcccttgcctccctcaatgaaaaactgc
atccagctggcagcctgtgaggcccacgagctcctgccgatgatccctgacctcccagcc
gacctgttcacatcctgcctcaccactcccatcaagattgctttgcgctggttttgcatg
cagaagtgtgttagtctggtgcctggagtcacactggatttgatagaaaagatccctggc
cggctgaatgaccggagaacccctctgggtgaactgaactggatcttcacagccatcaca
gacaccatcgcctggaatgtgctccctcgggatctctttcaaaagcttttccgacaggac
ctgctggtggcaagtttgtttagaaattttttattggcagaaagaatcatgaggtcgtat
aactgcaccccagtaagcagcccacgacttcccccaacatacatgcatgccatgtggcag
gcctgggaccttgctgtggacatttgcctctctcaactgccaaccatcatcgaagaggga
actgccttcaggcacagcccattctttgctgagcagctgacggcattccaggtgtggctc
accatgggtgtggaaaacaggagcccccccgagcagctgcccatcgtcctacaggtgctg
ctaagccaggtgcaccggctgagagccttggacttgctgggacgatttttggacttgggc
ccttgggcggtgagcttggccctgtcggtgggcatcttcccctatgtactgaagctgctt
cagagctcggcccgagagctgcggccactccttgtcttcatctgggccaaaatcctcgct
gtggacagttcatgccaggctgacctcgtgaaggacaacggtcacaagtacttcctgtcc
gtcttggcagacccatacatgccagctgaacacaggaccatgacagccttcattcttgct
gtaatcgtcaacagctacacaacagggcaagaagcctgcctgcaggggaacctgattgcc
atctgtttggagcagctcagtgacccacaccccttgctacgccagtgggtggccatttgc
ctgggaaggatctggcagaactttgattctgcaaggtggtgtggggtgagagacagcgcc
cacgaaaaactctatagcctcctctccgaccccatccctgaggtacgatgtgcagctgtg
tttgcccttggtacctttgtgggaaactctgctgagaggacagaccactctactaccatt
gaccacaatgtggccatgatgctggctcagctgattaatgatggaagccccatggtccgg
aaggagctggtggtggctctgagtcaccttgtagtccaatatgagagcaatttctgcact
gtggccctgcagttcatggaagaggaaaagaactaccccttgccttctccagcagccaca
gagggagggagcttgactccagttcgagacagcccgtgcacccccagactccggtcagtg
agctcctatgggaacatccgagccgtcaccacagctaggaacctgaacaaatctttgcag
aacctgagcttgacggaagaatcgggcagctcagtggccttctctcccgggaacctcagt
acaagtagtagtgccagcagcaccttgggaagccctgagaacgaggagtatatcctgtcc
ttcgagaccatcgacaagatgcggcgtgtgagctcctattcagcgctcaactccctcata
ggagtctcctttaatagtgtctacactcagatttggagagtcttactgcatttggccgct
gatccctacccagatgtttctgacttagccatgaaagtcctcaacagcattgcttacaag
gccacagtcaacgcccggccccagcgaatcctcgacacatcctctctcacacagtcggcc
ccagccagcccaaccaacaagggcatgcacatccaccaggtgggaggctccccgccagca
tctagcaccagcagctgcagcctgaccaatgatgtggccaagcagacggtcagccgtgac
ctgccctccagccgcccgggtactgccggccccacaggggcacagtacacccctcactcc
caccagttccctcgtacacgaaagatgtttgacaaaggccctgatcagaccacagacgat
gcagatgatgctgccggacacaagagcttcatttgtgccactatgcagacggggttctgt
gactggagtgcccgctactttgcccagccggtcatgaagatccctgaagagcatgaccta
gagagtcagatccgcaaggagcgtgagtggcggttcctgaggaacactcgagtcaggaag
caggcacagcaggtcatccagaagggcatcaccagactggatgatcagatatttctgaac
aggaaccccggcgttccctctgtggtcaaattccacccctttacaccatgcatagctgtt
gctgacaaggacagcatctgtttttgggactgggagaaaggagagaaactggactacttc
cacaatggtaaccctcggtacaccagagtcactgctatggagtacctgaatgggcaggac
tgctccttgctgctgacagccacagacgatggagccatcagggtctggaaaaattttgct
gatttggaaaagaatccagagatggtgactgcgtggcaagggctctcagacatgcttcca
acaacacgaggagctgggatggtggtggactgggaacaagaaactggcctcctcatgagc
tcaggggacgtgcgcattgtccggatctgggataccgaccgggagacgaaggtccaggac
atccccacgggggccgacagctgtgtgacaagtttatcttgtgattcgcaccgctcactc
attgtagctggcctgggtgatggctcgatccgtgtctacgacaggaggatggcactcagt
gaatgccgggtcatgacttaccgagagcacacagcatgggtggtaaaggcctacctgcag
aagcaccctgagggccacatcgtgagtgtgagtgtcaatggagatgtgcgattcttcgat
cctcggatgcctgagtctgtgaatgtaatgcagattgtgaaggggctgacagccctcgac
atccacccccaggcaaacctgatcgcctgtggctccatgaaccagttcacagccatctac
aacggcaatggggagctgatcaacaacatcaaatactacgatggcttcatgggccagcga
gtcggggccatcagctgcctggctttccacccacactggcctcatctggccgtcggaagc
aatgactactacatttctgtatattcggtggagaagcgtgtcagatag

DBGET integrated database retrieval system