KEGG   Rattus norvegicus (rat): 288306Help
Entry
288306            CDS       T01003                                 

Gene name
Usp16
Definition
ubiquitin specific peptidase 16 (EC:3.4.19.12)
Orthology
K11844  
ubiquitin carboxyl-terminal hydrolase 16/45 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
11q11
AA seq 825 aa AA seqDB search
MGKKRTKGKSVPEKASSESTEPMCRHLRKGLEQGNLKKALVNVEWNICQDCKTDNKVKDK
SEEEAEDPSVWLCLKCGHQGCGRDSQEQHALKHYTTPRSEPHYLVLSLDNWSVWCYKCDE
EIKYCSSNRLGQVVDYVRKQAGRITSKPEKNNGHIELENKKLEKESKNEQEREKSESMAK
ENIPLDSASQITVKGLSNLGNTCFFNAVMQNLSQTPVLRELLKEVKMSGTIVKIEPPDLA
LTEPLEVNLEPPGPLTLAMSQFLNEMQENKKRIVTPKELFSQVCKKATRFKGYQQQDSQE
LLRYLLDGMRAEEHQRVSKGILKAFGNSTEKLDEEVKNKVKDYEKKKAIPSFVDRIFGGE
LTSTIMCDDCRTVSLVHESFLDLSLPVLDDQSGKKNINDKNVKKTMEEEDKDSEEEKDDS
YMKTRSDVPSGTSKHTQKKAKKQAKKQAKNQRRQQKIQERFLHFNEICTTNYTEDNDHEA
ETALPGEGEVDTEFNRGSQEELTQTELCANQKDVNGQEEMIESAADERKCPEHPEVKSVS
TESDLGSLTSAPECPRDLNGAFLEERTSGELDITNGLKNLTLNAAVDPDEISIEILNDSH
SPALKVYEVMNEDPETAFCTLANREAFSTDECSIQHCLYQFTRNEKLQDANKLLCEVCTR
RQCNGPKANIKGERKHVYTNAKKQMLVSLAPPVLTLHLKRFQQAGFNLRKVNKHIKFPEI
LDLAPFCTLKCKNVAEESTRVLYSLYGVVEHSGTMRSGHYTAYAKERTASCHLSNLVLHG
DIPQDCEMESTKGQWFHISDTHVQAVPITKVLNSQAYLLFYERIL
NT seq 2478 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagaaacgaacaaaggggaaaagtgttccagaaaaggcttcttctgaatctaca
gaaccaatgtgcagacaccttagaaaagggttggaacaaggtaatttgaaaaaagctttg
gtaaatgtggaatggaatatctgccaagactgtaagactgacaataaagtgaaagataaa
tctgaggaagaagcagaagacccttcggtttggctgtgtcttaaatgtggccatcagggc
tgtggcagagattcccaggagcagcatgccctgaagcactacacaacaccaaggtctgaa
cctcactacctggtgcttagtttggacaactggagcgtctggtgttacaagtgtgatgag
gaaatcaagtactgcagttcaaaccggctgggccaagtggttgattatgttagaaagcaa
gctggcagaataacttcaaaaccagagaaaaataatggacacattgagcttgaaaataaa
aaattggagaaagagagtaaaaatgaacaagagagagaaaaatcggaaagcatggctaaa
gaaaacatccccttggactctgcttcccagataacggtgaaaggactcagcaacttgggg
aatacttgtttcttcaacgctgttatgcagaacttgtcacaaacgccagtgcttagagaa
ctactaaaagaagtgaagatgtctggaacaattgtaaaaatagagccacctgatctggca
ctcacagaacctttagaagtaaaccttgaacctccaggtcctcttactttagccatgagc
cagtttcttaatgagatgcaagagaacaaaaaacgaattgtaacacctaaagagctcttt
tctcaggtctgtaaaaaagcaacacgttttaaagggtaccaacaacaagacagccaggag
ctgcttcgctacctattggacgggatgagagcggaagagcaccaaagagtgagtaaagga
attcttaaagcatttggtaattctactgaaaaattggatgaagaagtaaaaaataaagtt
aaagattatgaaaagaaaaaggcaatcccaagttttgtggaccgcatcttcggtggcgaa
ctgactagtacaatcatgtgtgatgactgcaggactgtctccttggtgcatgagtctttc
cttgatttgtctctcccagttttagatgatcagagtggtaagaaaaatataaatgataaa
aatgtgaagaagacaatggaggaagaagataaagacagtgaggaagagaaagatgacagc
tacatgaaaacacggagtgacgtgccctcaggaacaagcaagcacacacagaagaaagca
aagaagcaagccaaaaagcaagccaagaaccaacgaaggcaacaaaaaattcaagaaagg
tttcttcacttcaacgagatctgcaccactaactacactgaagacaatgaccatgaagct
gagacggcacttccgggagaaggggaagtggatactgagttcaaccgtggctctcaagag
gagctcacacagacagagctctgtgctaatcagaaagatgtgaatggccaagaggaaatg
atagaaagcgctgccgatgagcggaaatgcccagagcacccggaggtgaaaagtgtcagc
accgagagtgatctggggagtttgacttctgctcctgagtgtcctagagatttaaatggt
gccttcctggaagaaaggaccagtggagagctagacattaccaatggtttaaaaaacctt
actttgaatgctgctgttgatcctgatgaaataagtatagagattctgaatgacagccat
tctcctgcgttaaaggtgtatgaggtcatgaatgaggacccagaaactgctttctgtacc
cttgcaaaccgggaagcttttagtactgatgagtgttcaatccaacattgtttgtatcag
ttcacccgcaatgagaaacttcaagatgcaaataaactgctttgtgaagtgtgcacaaga
cggcagtgtaatggaccaaaggcaaatataaaaggtgaaaggaaacatgtttacaccaat
gccaagaagcagatgctggtttcccttgctcctcctgtactcactcttcatttaaagaga
tttcagcaggctggttttaacctacgcaaagttaacaaacacataaagtttccggaaatc
ttagatttggctcctttttgtacccttaaatgtaagaacgttgctgaggaaagtacaaga
gtgctgtattccttatatggagttgtggaacacagtggcactatgaggtcagggcattac
actgcctacgcaaaggaaagaactgcaagctgtcatctctctaatcttgttcttcatggt
gacattccgcaagattgtgaaatggagtcaaccaaagggcagtggtttcacatcagcgac
acacacgtgcaagcggtgcctataactaaagtactgaactcacaagcttatctcctattt
tatgagagaatactgtga

DBGET integrated database retrieval system