KEGG   Rattus norvegicus (rat): 288333Help
Entry
288333            CDS       T01003                                 

Gene name
Gbe1
Definition
glucan (1,4-alpha-), branching enzyme 1 (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
rno  Rattus norvegicus (rat)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    288333 (Gbe1)
Enzymes [BR:rno01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     288333 (Gbe1)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   288333 (Gbe1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
11p11
AA seq 702 aa AA seqDB search
MAAPAAPAAEEKGSEAQLKAALADVPELGRLLEIDPYLKPYAADFQRRYKKFNQVLHDIG
ENEGGIDKFSRGYESFGIHRCSDGGIYCKEWAPGAEGVFLTGEFSGWNPFSHPYKKLEYG
KWELYIPPKQNKSPPIPHGSKLKVVITSKSGEILYRISPWAKYVVRENNNVNYDWIHWDP
ENPYKFRHSRPKKPRSLRIYESHVGISSHEGKIASYKHFTSNVLPRIKDLGYNCIQLMAI
MEHAYYASFGYQVTSFFAASSRYGTPEELKELVDTAHLMGIVVLLDVVHSHASKNSEDGL
NMFDGTDSCYFHSGPRGTHDLWDSRLFIYSSWEVLRFLLSNIRWWLEEYCFDGFRFDGVT
SMLYHHHGMGQGFSGDYSEYFGLQVDEDALVYLMLANHLTHTMYPDSITIAEDVSGMPAL
CSPTSQGGGGFDYRLAMAIPDKWIQLLKEFKDEDWNMGNIVYTLTNRRHLEKCVAYAESH
DQALVGDKTLAFWLMDAEMYTNMSVLAPFTPVIDRGIQLHKMIRLITHGLGGEGYLNFMG
NEFGHPEWLDFPRKGNNESYHYARRQFNLTDDDLLRYKFLNNFDRDMNRLEETCGWLSAP
QAYVSEKHEGNKTITFERAGLLFIFNFHPSKSYTDYRVGTAMPGKFKIVLDSDAAEYGGH
QRLDHSTDYFAEAFEHNGRPYSLLVYIPSRVALILQNVDLPN
NT seq 2109 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgccggcggctcctgcggcagaggagaagggctccgaagctcaactgaaggcc
gccttggccgatgtgccggagctgggccgacttctggagattgacccgtacctgaagccc
tacgccgcagacttccagcgcaggtataagaagtttaaccaggttttgcatgacattgga
gagaatgaaggtggtattgataagttctccagaggctatgagtcatttggcatccacaga
tgttccgatggtggcatatactgtaaagaatgggccccaggagcagaaggagtttttctt
actggagaattcagtggttggaatccattttctcatccatataaaaagctggaatatggg
aaatgggagctgtacatcccacccaagcagaataaatctcccccaatacctcatgggtcc
aaactgaaggtagttattaccagtaagagtggtgagattctgtaccgcatctccccgtgg
gcaaagtatgtggttcgcgagaacaacaacgtgaactacgattggatacactgggatcca
gaaaacccctacaaattcaggcattccagacctaagaaacccagaagcctaagaatttat
gaatctcatgtgggaatttcttcccatgaaggaaagatagcttcttataaacattttact
agcaatgtactaccaagaatcaaagaccttgggtacaactgcattcagttgatggcgatc
atggaacacgcctactatgccagctttgggtaccaagtcaccagcttttttgcagcttca
agccgttatggaactcctgaagagctgaaagaacttgtcgacacagcacatttgatgggc
attgtcgtcctcttggacgtggtacacagccatgcttctaaaaactcagaagacgggtta
aacatgtttgatgggaccgattcctgttactttcattctggacccagaggaacccatgat
ctttgggacagtagattatttatctattccagctgggaagtcttaaggttccttctgtcg
aacataagatggtggttggaggaatactgctttgacggcttccgttttgacggtgtcacc
tccatgctgtatcatcaccatggcatgggtcaaggtttttcaggcgactacagtgaatat
tttggactccaagtagatgaagacgctctggtttacctcatgttggcaaatcatttgacg
cacacgatgtacccagactcgataactatagcagaggatgtatcagggatgccggccctc
tgttctccaacgtcccagggaggaggtggttttgattacagattagcaatggccattccg
gataaatggatccaattacttaaggaattcaaagatgaagactggaacatgggcaatata
gtgtatacgctcaccaatcgacgccaccttgaaaaatgcgtggcttatgcagagagccat
gatcaggcactggttggtgacaagacactggcattttggttgatggacgccgagatgtac
acgaacatgagcgttctggcgcctttcaccccagtaattgatcgaggaatacagcttcac
aagatgattcgactcatcactcacgggcttggtggagaaggctatctcaattttatgggg
aatgagtttgggcatcctgaatggttggacttcccaaggaagggaaataatgagagttac
cattatgccagaaggcagtttaacttaaccgatgacgaccttcttcgttataagttcctg
aataactttgacagagatatgaacagactggaagaaacatgtggttggctctcggctccg
caggcctacgtgagtgaaaagcacgaaggcaataagacaatcacctttgagagagcagga
cttctttttattttcaacttccacccaagcaagagctatacggactaccgagtcgggaca
gccatgccagggaagttcaaaattgtattagattcagatgcagcagaatatggaggacat
cagagactggaccacagcaccgactactttgccgaggcttttgaacataatgggcgcccc
tattcccttttggtgtacattccaagccgagtggctctcatccttcagaacgtggatctg
ccaaactga

DBGET integrated database retrieval system