KEGG   Rattus norvegicus (rat): 288482Help
Entry
288482            CDS       T01003                                 

Gene name
Usp42
Definition
ubiquitin specific peptidase 42 (EC:3.4.19.12)
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     288482 (Usp42)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   288482 (Usp42)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
12p11
AA seq 1325 aa AA seqDB search
MTIVDKTEPSDPSTCQNQPGSSEAVSPEDMDTGSASWGAVSSISDVSNHTLSLGPVPGAV
VYNNSSVPEKSKPSPPKDQVLGDGIAPPQKVLFPSEKICLKWQQSHRVGAGLQNLGNTCF
ANAALQCLTYTPPLANYMLSHEHSKTCHAEGFCMMCTMQTHITQALSNPGDVIKPMFVIN
EMRRIARHFRFGNQEDAHEFLQYTVDAMQKACLNGSNKLDRHTQATTLVCQIFGGYLRSR
VKCLNCKGVSDTFDPYLDITLEIKAAQSVTKALEQFVKPEQLDGENSYKCSKCKKMVPAS
KRFTIHRSSNVLTISLKRFANFTGGKIAKDVKYPEYLDIRPYMSQPNGEPIIYVLYAVLV
HTGFNCHAGHYFCYIKASNGLWYQMNDSIVSTSDIRSVLNQQAYVLFYIRSHDVKNGGET
THPAHSPGQSSPRPGISQRVVNSKQAAPGFIGPQLPPHVMKNTPHLNGTTPVKDTPSSSV
SSPNGNTSVNRASPATASTSVQNWSVNRPSVIPEHPKKQKITISIHNKLPVRQGQAQLNN
NLHGPCLEAPSKAAPSSTITNPSAIQSTSNAPTTSVSPSESCPKPMVNGKAKVGSSVLVP
YGAESSEESDEESKGLAKENGVDMMTSTQSSRPETADEDGEASPHELQESVMLNGANSAD
SDSRESSLAFDSASCQVQPDLHTENLFNKLNGLPGKVTPAPLQSVPEDKILETFKLTNQA
KGPAVEESWTTTGGSSPRASVSQPEPITDETSPLEIPEAVTNGSMKTPSTTSPLEPTISC
TKEDSSVVVVSAEPMEVLPSVPALCNSTGTTLGDAPVPESCDPGDLTANPSQPSQAVKGD
PAENSENSTLAEVVERLSPAPSVLTGDGCEQKLFLYLSTEGSEEAEDSSRSSAVSADTVP
PQPDRTTSSCAGAAEQAAGDRGDGGSVGPKAQEPSPAKEKMNSLRKVDRGHYRSRRDRSS
SGEHVRDSRARPEDHHHKKRRCYSRERPKQERHPANTYCNGGQHLGHGDRASPERRSLSR
YSHHHSRVRSGLEQDWSRYHHSENEPAWARERFYPDKMRWDKCRYYHDRYTTTLYTAREA
AREWRPLHGREHERLVQSGRPHKDSYWGRKGWDLQSRGKERPHFHSPREAPGLAVPLERH
LQEKAALSVQDSSHSLPERFHEHESVKLRKRRYETLDNNDDHPEKKVHKSLEKDALEEPR
AKKHKKSKKKKKSKDKHRARDSRHQQESDFSGAYSDADLHRHRKKKKKKKRHSRKSEDFI
KDVEMHLPKLSSYEAVGHFRRTEGTFLLADGLPVEDSGPFREKTKHLRMESRPDRCHLSE
YGQGN
NT seq 3978 nt NT seq  +upstreamnt  +downstreamnt
atgaccatagttgacaaaactgaaccttcagacccatcaacctgtcagaaccagcctggc
agttctgaggcggtctcacctgaagacatggacacaggctctgccagctggggtgccgtg
tcttccataagtgatgtctcaaatcatacactttcattggggccggtgcctggtgctgta
gtttacaataactcgtctgtacctgagaaatcaaaaccatcaccaccaaaggatcaagtc
ctaggtgatggcattgctcctcctcaaaaggtcctatttccatctgaaaagatttgtctt
aagtggcaacaaagtcatcgagttggcgctgggctgcagaatttgggcaatacctgtttt
gccaatgctgcgttgcaatgtctgacttacacaccacccctcgccaactacatgctatcc
catgaacactccaagacatgccatgcagaaggattctgtatgatgtgcacaatgcagacg
cacattacccaggcacttagcaaccctggggatgttatcaagcccatgttcgtcatcaat
gaaatgcggcgtatagctagacatttccgttttggtaaccaagaagatgcccatgaattt
cttcagtacacggtcgatgccatgcagaaagcatgtttaaatggcagcaataaattagac
agacatacccaggccaccaccctggtctgccagatatttggaggctacctaagatcccga
gtcaagtgtttaaattgcaagggtgtttcagacacctttgatccatacctggacataaca
ctggagattaaggctgcacagagcgttaccaaggcgctggaacagttcgtgaagccagaa
caactggatggagaaaactcctacaaatgtagcaagtgcaaaaagatggttccagcttca
aagagattcaccatccataggtcctctaatgttcttaccatttcactgaaacggtttgcc
aactttaccggtggaaaaattgctaaggacgtgaaatatcccgagtaccttgatatccgg
ccctatatgtctcagcccaacggagagcccatcatttatgttttgtatgctgtgctggtg
cacaccggttttaactgtcatgctggccactacttttgctacatcaaggctagcaatggc
ctctggtatcagatgaatgactctatcgtgtccaccagtgatattagatcggtgcttaac
cagcaggcttacgtgctcttttatatcaggtcccatgatgtgaaaaatggaggggagacc
actcatcctgcccatagccctggccagtcctccccccggccagggatcagtcagcgtgta
gtcaacagcaagcaggcggcgccaggattcatcgggccgcagctgcctccccatgtgatg
aagaacacaccacacttgaatggcaccacgccggtgaaagacacaccaagcagttctgtt
tcaagccctaacggaaacaccagcgtcaatagggccagtcctgctacggcttcgacgtct
gtgcagaactggtctgttaacaggccctcagttattccggaacaccctaagaaacaaaaa
attactatcagtattcacaacaagttgcctgttcgtcaaggtcaggcacagctgaataac
aacctccatggcccttgtctggaggcccctagcaaggcggccccctcctccaccatcact
aacccttctgcaatacagtctacctcgaatgcacccacgacatcagtttccccaagtgag
tcctgtcccaagcccatggtgaatggcaaggctaaagtgggctccagtgtgctcgtcccc
tatggggctgagtcctcagaggagtctgatgaggagtccaagggcctggccaaggagaac
ggtgtggacatgatgaccagcactcagtccagtagaccagaaaccgcagatgaggacggt
gaggcttcccctcatgagcttcaagagtccgtcatgctaaatggtgctaatagcgcagac
agtgactcgagagagagcagcctggcatttgacagtgccagctgccaggtccagcccgat
ctacacacagaaaacctctttaacaaactcaatggtcttcctggaaaggtgacgcccgct
ccattgcagtctgttcctgaagacaaaatccttgagactttcaagcttaccaaccaggca
aaaggtccagcggttgaagagagttggactacaacagggggaagctctccaagggcctct
gtttcacagccggagcccatcaccgatgagaccagtccccttgagataccggaggcagtc
accaacgggagcatgaagaccccttccaccacgtcacctctggagcccaccatcagctgt
accaaagaagactcttccgtcgtcgtcgtctcagcagaacctatggaggttttgccttcc
gtccctgctctctgtaacagcaccggtactaccttgggggatgccccagtgcccgaatcg
tgtgaccctggagacttgactgccaacccgagccaaccatcgcaagcggtgaagggtgat
ccagctgagaactctgagaactccaccttggctgaagtggtggagaggctgagccctgct
ccctctgtgctcacaggggacgggtgtgagcagaaactcttcctttacctcagtacagag
gggtccgaggaggcagaagactcctccaggagctcggcagtctctgctgacacggtgccc
cctcagcctgacaggaccaccagctcctgtgcaggggctgccgagcaggctgccggggat
agaggcgatggaggcagtgtgggacccaaagctcaggagccctccccggccaaggaaaag
atgaacagccttcggaaagtggatcgaggacactatcggagccggagagaccggtcctcc
agtggggagcacgtgagggacagcagggcccgaccagaggaccatcaccataagaagcgg
cgctgctacagccgagagcggcccaagcaggagcgccaccctgctaacacatactgcaat
gggggccagcacctgggccacggcgacagagccagccccgagcgccgctccctgagcagg
tacagccaccatcactcacgggttaggagtggcctggagcaggactggagccggtaccac
cactcggaaaatgagcctgcctgggccagggagaggttctacccggacaagatgcgctgg
gacaagtgtaggtattaccacgacaggtacactacgaccctgtacacggcccgggaggca
gcccgcgagtggcggcctctacatggtcgtgagcatgaacgccttgtccagtctggacgg
ccacacaaggacagctactggggccgcaagggctgggacctacaatcccgggggaaggaa
cggccccacttccatagcccacgagaggcccctggccttgctgtacccctcgagaggcat
ctccaagagaaggctgcgctgagtgtgcaggacagcagccacagtctccctgagcgcttt
catgaacacgaaagtgtcaagttgaggaaaaggaggtatgagactctagacaataatgac
gaccatccagaaaagaaagtccacaaaagcctggagaaggacgcgctagaagagccaagg
gcaaagaagcacaaaaaatctaaaaagaaaaagaagtccaaagataaacaccgggctcgg
gatagcaggcaccagcaagaatccgacttttcaggagcatactctgatgctgacctccat
agacaccggaagaaaaagaagaaaaagaaaaggcattcaaggaagtcggaggactttata
aaagatgttgagatgcatttaccgaagctctcgagctatgaggccgttggccatttccgg
agaacagagggcacctttctactggctgatggtctgcctgtggaagacagcggccctttc
cgggagaaaacgaagcatttaaggatggaaagccggcctgacagatgtcatctgtcagag
tatggccagggtaactaa

DBGET integrated database retrieval system