KEGG   Rattus norvegicus (rat): 288516Help
Entry
288516            CDS       T01003                                 

Gene name
Eif3b, Eif3s9
Definition
eukaryotic translation initiation factor 3, subunit B
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
rno  Rattus norvegicus (rat)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:rno03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
12q11
AA seq 797 aa AA seqDB search
MQDAENVAAPEAAEERAEPARQQPVSESPPTDEAAGSGGSEVGRTEDAEEDAEARPEPEV
RAKPAAQSEEETAASPAASPTPQSAQEPSAPGKAEAGGEQARHPSARAEEEGGSDGSAAE
AEPRALENGEADEPSFSDPEDFVDDVSEEELLGDVLKDRPQEADGIDSVIVVDNVPQVGP
DRLEKLKNVIHKIFSKFGKIINDYYPEEDGKTKGYIFLEYASPAHAVDAVKNADGYKLDK
QHTFRVNLFTDFDKYMTISDEWDIPEKQPFKDLGNLRYWLEEAECRDQYSVIFESGDRTS
IFWNDVKDPVSIEERARWTETYVRWSPKGTYLATFHQRGIALWGGDKFKQIQRFSHQGVQ
LIDFSPCERYLVTFSPLMDTQDDPQAIIIWDILTGHKKRGFHCESSAHWPIFKWSHDGKF
FARMTLDTLSIYETPSMGLLDKKSLKISGIKDFSWSPGGNIIAFWVPEDKDIPARVTLMQ
LPTRQEIRVRNLFNVVDCKLHWQKNGDYLCVKVDRTPKGTQGVVTNFEIFRMREKQVPVD
VVEMKETIIAFAWEPNGSKFAVLHGEAPRISVSFYHVKSNGKIELIKMFDKQQANTIFWS
PQGQFVVLAGLRSMNGALAFVDTSDCTVMNIAEHYMASDVEWDPTGRYVVTSVSWWSHKV
DNAYWLWTFQGRLLQKNNKDRFCQLLWRPRPPTLLSQDQIKQIKKDLKKYSKIFEQKDRL
SQSKASKELVERRRTMMEDFRQYRKMAQELYMKQKNERLELRGGVDTDELDSNVDDWEEE
TIEFFVTEEVIPLGSQE
NT seq 2394 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgctgagaacgtggcggcgcccgaggcggccgaggagcgggccgagcccgcg
aggcagcagccggtctccgagtcaccgccgacggacgaggcggcagggtctggcgggtcc
gaagtggggcggacggaagacgccgaggaagacgccgaggccagaccggagcccgaggtg
agggccaagccggcggcccaatccgaagaggaaacggcggcgagtccggccgcctcgccc
acgccgcagtcggcgcaggagccctctgctcccgggaaggcggaggccggcggagagcag
gccaggcacccctcggctagagcggaggaggagggcgggtccgatgggagcgcggccgag
gcggagccgcgggctctggagaacggagaggcagatgagccctccttcagcgaccccgag
gatttcgtagacgacgtgagcgaggaagaactacttggtgatgtactcaaagatcggcct
caggaagcggatgggattgactcggtgattgttgtagacaacgttcctcaggtgggaccc
gaccggcttgagaagctcaaaaatgtcatccacaagatcttctccaagtttgggaaaatc
ataaatgactattaccctgaagaggatggaaagacgaaagggtacatctttctggaatat
gcttctcccgcccatgctgtggatgctgtgaaaaatgcagatggatacaagctggacaag
cagcacacgttccgggtcaacctcttcactgattttgataagtacatgaccatcagtgac
gagtgggacatcccagagaagcagcctttcaaagacctgggcaatctgcgctattggctg
gaagaggcagagtgtagagatcagtacagtgtgatttttgagagcggagaccggacatcc
atcttctggaatgacgtcaaggacccagtctcaatcgaagaaagagcgagatggacagag
acatatgtgcgctggtcccctaagggcacctacctggccaccttccatcagcggggtatc
gccctctggggaggggacaagttcaagcagatccagaggttcagccaccaaggcgtgcag
ctcatcgatttctcaccttgtgaaagatacctggtgactttcagcccactgatggacact
caggatgaccctcaggccatcattatctgggacatcctcacagggcataagaagagaggt
tttcactgtgaaagctcagcccactggcccatcttcaagtggagccatgatggcaaattc
tttgcaagaatgaccctggatacccttagcatctatgaaacaccttccatgggccttttg
gacaagaagagcttgaagatctctggaataaaagacttttcttggtctccgggtggtaac
atcattgccttttgggtgccagaagacaaagatattccagccagggtgaccctgatgcag
ctccccaccagacaggagatccgagtgaggaatttgttcaatgtggttgattgcaagctg
cactggcagaaaaatggagattacctgtgtgtaaaagtggacaggactccaaaaggcaca
cagggagttgtcacaaattttgaaatcttccgaatgagggagaagcaggttcctgttgac
gttgttgagatgaaagagaccatcatagcctttgcctgggaacccaatggcagtaagttt
gctgtgcttcatggtgaggcccctcggatatctgtctccttctaccacgtgaagagcaat
gggaagattgaactcatcaagatgtttgacaagcagcaagccaataccatcttctggagt
ccccaggggcagttcgtggtactggccgggctgaggagcatgaatggcgccttggcgttt
gtcgacacttcagactgcaccgtcatgaacattgcagagcactacatggcctccgacgtc
gaatgggacccaactggccgctatgtggttacctctgtgtcgtggtggagccataaggtg
gacaatgcttattggctgtggaccttccaaggtcgtcttctccagaagaacaacaaggac
cgcttctgccagctgctctggagaccaaggcccccaacactcctcagtcaggatcagata
aagcaaattaaaaaggatctgaagaaatactctaagatctttgagcagaaggatcgcttg
agccagtccaaagcttcaaaggaactggtggaaagaaggcggaccatgatggaggacttc
aggcaataccgaaaaatggcccaggaactctatatgaagcagaagaacgagcgtctagag
ctacggggaggggtggacactgacgagctggacagcaacgtggatgactgggaggaagag
accattgagttttttgtcactgaagaggtcattcctctgggaagtcaggagtga

DBGET integrated database retrieval system