KEGG   Rattus norvegicus (rat): 288615Help
Entry
288615            CDS       T01003                                 

Gene name
Sbds
Definition
(RefSeq) SBDS ribosome assembly guanine nucleotide exchange factor
  KO
K14574  
ribosome maturation protein SDO1
Organism
rno  Rattus norvegicus (rat)
Pathway
Ribosome biogenesis in eukaryotes
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Translation
   03008 Ribosome biogenesis in eukaryotes
    288615 (Sbds)
Ribosome biogenesis [BR:rno03009]
 Eukaryotic Type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    288615 (Sbds)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
RGD: 
UniProt: 
Position
12q12
AA seq 250 aa AA seqDB search
MSIFTPTNQIRLTNVAVVRMKRGGKRFEIACYKNKVVGWRSGVEKDLDEVLQTHSVFVNV
SKGQVAKKEDLISAFGTDDQTEICKQILTKGEVQVSDKERHTQLEQMFRDIATIVADKCV
NPETKRPYTVILIERAMKDIHYSVKPNKSTKQQALEVIKQLKEKMKIERAHMRLRFLLPV
NEGKKLKEKLKPLMKVVESEDYSQQLEIVCLIDPGCFREIDELIKKETKGKGSLEVLSLK
DVEEGDEKFE
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
atgtcgatcttcacccccaccaaccagatccgactgaccaatgtagccgtggtgcggatg
aagcggggagggaagcgcttcgaaatcgcctgctataaaaacaaggtcgtcggctggcgg
agtggagtggaaaaagaccttgatgaagttctgcagacccattcagtgtttgtcaatgtt
tccaaaggtcaggttgccaagaaggaagacctcatcagtgcatttgggaccgacgaccag
actgaaatctgcaagcagattctgactaaaggagaagttcaagtgtcagataaagaacgg
cacacacagctggagcagatgtttagggatattgccaccattgtggcagacaagtgtgtg
aacccggaaacaaagagaccctacaccgttatcctcatcgagagagccatgaaggacatc
cactactccgtcaaacccaacaagagcaccaagcagcaggcgctggaggtgataaagcag
ctgaaggagaagatgaagatcgagagggcgcacatgcgcttgcgcttcctcctgccggtg
aacgagggaaagaagctgaaggaaaagctgaagcccctgatgaaggtcgtggagagtgag
gactacagccagcagctggagatcgtatgcctcatcgacccaggctgcttcagagaaatt
gacgagctgataaaaaaggaaacgaaaggcaagggttctctggaagtgctcagtctgaaa
gacgtggaggagggagatgagaagtttgaatga

DBGET integrated database retrieval system