KEGG   Rattus norvegicus (rat): 288731Help
Entry
288731            CDS       T01003                                 

Gene name
Pgam5, RGD1312028
Definition
(RefSeq) phosphoglycerate mutase family member 5 (EC:3.1.3.16)
  KO
K15637  
serine/threonine-protein phosphatase PGAM5 [EC:3.1.3.16]
Organism
rno  Rattus norvegicus (rat)
Pathway
TNF signaling pathway
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04668 TNF signaling pathway
    288731 (Pgam5)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     288731 (Pgam5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
12q16
AA seq 288 aa AA seqDB search
MAFRQALQLAACGLAGGSAAVLFSAVAVGKPRAGGDADTRTTEPLAWTGARPGHGVWDSN
WDRREPLSLINLKKRNVEFGEDELASRLDHYKAKATRHIFLIRHSQYNVDGSMEKDRTLT
PLGREQAELTGIRLASLGLKFNKIVHSSMTRAVETTDIISKHLPGVCRVSTDLLREGAPI
EPDPPVSHWKPEAVQYYEDGARIEAAFRNYIHRADAKQEEDSYEIFICHANVIRYIVCRA
LQFPPEGWLRLSLNNGSITHLVIRPNGRVALRTLGDTGFMPPDKITRS
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atggctttccggcaggctcttcagctggcggcctgtggtctggcgggtggctcggccgct
gttctcttctcggcggtagcggtagggaagccgagagctggcggggatgcagacacgcgc
acgacagagccgctggcctggaccggagcgcgccccgggcacggcgtctgggactccaac
tgggacaggcgagagccactgtcactcattaacctgaagaaaaggaacgtggaatttgga
gaagatgaactggcttccaggctggaccactataaggcaaaggctacaagacacatattc
ctcatccggcattcccagtacaatgtggatggctcgatggagaaggaccgcaccctgacc
ccattaggtcgggaacaggctgaactcacggggatccgacttgcaagcctgggactgaag
tttaataaaatcgtccattcctctatgacccgtgcagtagagaccacagacatcatcagt
aagcacctgccaggtgtctgcagagtcagcacagacttgctacgggaaggtgcccccatt
gaaccggatccacctgtgtctcactggaagccagaggctgtgcagtattatgaagatgga
gcccggattgaggctgccttcaggaactacatccaccgagctgatgccaagcaggaggag
gacagctacgagatcttcatatgtcacgccaatgtcatccgttatattgtttgtagggca
ctgcagtttcccccagaaggttggctccgcctgtccctcaacaatggtagtatcacccac
ctggtgattcgacccaatggtcgtgttgcactcaggacccttggggacacagggttcatg
cccccagacaagattactcggtcctga

DBGET integrated database retrieval system