KEGG   Rattus norvegicus (rat): 289481Help
Entry
289481            CDS       T01003                                 

Gene name
Gk2, Gk-rs2
Definition
glycerol kinase 2 (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycerolipid metabolism
Metabolic pathways
PPAR signaling pathway
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:rno00561]
Organismal Systems; Endocrine system; PPAR signaling pathway [PATH:rno03320]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
14p22
AA seq 554 aa AA seqDB search
MADSKETPEEPLVGAVVQGTNSTRFLVFNPKTAELVGSHQVELTQEYPKEGWVEEDPKEI
LQSVYECIAKTCEKLTEANIDTSKIKAIGVSNQRETTVVWDKFTGEPLYNAVVWLDLRTQ
STVESLNKKIPGNSNFVKSKTGLPLSTYFSAVKLRWMLDNLRPIQKAVEEDRALFGTIDS
WLIWCMTGGVNGGIHCTDVTNASRTMLFNIHSLEWDKELCKFFEIPMSILPNVRSSSEIY
GQMTSGALEGVPISGCLGDQSAALVGQMCFQEGQAKNTYGTGCFLLCNTGQKCVFSEHGL
LTTVAYKLGKNKPAFYALEGSVAIAGAVIRWLRDNFELITSSGEVEDLAREVGTAYGCYF
VPAFSGLYAPYWEPSARGIICGLTQFTNKCHIAFAALEAVCFQTREIVDAMNRDCGIPLS
HLRVDGRMTNNKILMQLQADILHIPVVKSVMPETTALGAAMAAGAAEGIDVWSIEPEDLS
SMLMERYEPQIQATESEIRFSTWKRAVMKSMGWVTAKDPESNANPVFACLPLGFFIVSSM
TLLIGARCISYAEE
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcagactccaaggaaacccctgaggagccgttggtgggagcggtggtccagggaacc
aactccactcgctttctggttttcaatcccaaaacagcagaactagtcggcagtcatcag
gtggaactgacacaagagtatccgaaagaaggatgggtggaggaagatcccaaggaaatc
cttcagtctgtctatgaatgcatagcgaaaacttgcgagaaacttactgaggcgaacatt
gatacttccaagattaaagctatcggcgtgagtaaccagcgggaaaccactgtggtctgg
gacaagttcacgggagagcccctatacaatgccgtggtgtggcttgatctcagaacccag
tctactgtggagagtctcaataagaaaatcccagggaatagcaactttgtcaagtctaag
acaggccttccacttagcacttacttcagtgctgtgaaactgcggtggatgctggacaac
ctaagacccattcaaaaggctgttgaggaagacagagccctatttggaaccatcgactcg
tggctcatctggtgtatgaccggaggagtcaacggaggcatccactgtaccgatgtaaca
aatgcgagcagaacgatgcttttcaacatccactctttggaatgggataaagaactctgt
aaattttttgaaattccaatgagcatcctcccaaatgtacgcagttcttccgagatctac
ggccagatgacatccggggctttggaaggcgtgccaatatccggatgtttgggggatcag
tctgctgctttagtgggacaaatgtgcttccaggaaggtcaagccaaaaacacgtacgga
accggatgttttttactatgcaatacaggccagaaatgtgtattttctgaacatggcctt
ctgactacagtggcttacaaactaggcaaaaataagccagctttttatgccttagaaggc
tctgttgctatagctggtgctgttattcgctggctaagagacaatttcgaacttataacg
tcctcgggggaagttgaagatcttgcaagagaggtaggcacggcctacggctgctacttt
gtcccagccttttctgggttgtatgcaccttactgggaacccagtgcaagagggataatc
tgtggtctcactcagttcaccaacaaatgccatattgcctttgctgcattagaagccgtt
tgtttccaaacccgagagattgtggatgccatgaaccgcgactgtgggattccactcagt
catttgcgggtagatggaagaatgaccaacaacaagattctcatgcagctccaggcagat
attctgcacattccggtagttaaatctgttatgcccgaaaccacagccctgggagcagcc
atggcagccggagctgcagaagggatagatgtttggagtattgaacccgaagacttgtct
tcaatgttaatggaacgatatgaaccacaaatccaagccacagagagtgaaattcgtttt
tcaacatggaagagagcagtgatgaagtcaatgggttgggttacagccaaggatcctgaa
agtaacgctaaccctgtcttcgcttgcctgcccttggggttttttatagtgagtagcatg
acgttattaattggagcaaggtgtatctcatacgctgaagaataa

DBGET integrated database retrieval system