KEGG   Rattus norvegicus (rat): 289584Help
Entry
289584            CDS       T01003                                 

Gene name
Usp46, RGD1564808
Definition
ubiquitin specific peptidase 46 (EC:3.4.19.12)
Orthology
K11842  
ubiquitin carboxyl-terminal hydrolase 12/46 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
14p11
AA seq 366 aa AA seqDB search
MTVRNIASICNMGTNASALEKDIGPEQFPINEHYFGLVNFGNTCYCNSVLQALYFCRPFR
ENVLAYKAQQKKKENLLTCLADLFHSIATQKKKVGVIPPKKFISRLRKENDLFDNYMQQD
AHEFLNYLLNTIADILQEEKKQEKQNGKLKNGNMNEPAENSKPELTWVHEIFQGTLTNET
RCLNCETVSSKDEDFLDLSVDVEQNTSITHCLRDFSNTETLCSEQKYYCETCCSKQEAQK
RMRVKKLPMILALHLKRFKYMEQLHRYTKLSYRVVFPLELRLFNTSSDAVNLDRMYDLVA
VVVHCGSGPNRGHYITIVKSHGFWLLFDDDIVEKIDAQAIEEFYGLTSDISKNSESGYIL
FYQSRE
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgactgtccgaaacatcgcctccatctgtaatatgggcaccaatgcctctgctctggaa
aaagacattggaccagagcagtttccgatcaatgaacactacttcggattggtcaatttt
gggaacacatgctactgtaactccgtgctccaagcattgtacttctgccggccgttccgg
gagaatgtgttggcatacaaggcccagcagaaaaagaaggaaaacctgttgacgtgcctg
gcagaccttttccacagcattgccacgcagaagaagaaggttggcgtcatcccaccaaag
aagttcatttcaaggctgaggaaagagaacgatctctttgataactacatgcagcaggat
gctcatgaatttttaaattatttgctaaacactattgcggacatcctgcaggaagagaag
aaacaggaaaaacaaaacgggaaattaaaaaatggcaacatgaatgagccggcagagaat
agtaagccagaactcacctgggtccacgagatttttcagggaacactcactaacgaaact
cgatgcttgaactgtgaaactgtgagtagcaaagacgaagattttcttgacctctctgtt
gatgtggaacagaacacctccatcacccattgtctgagagacttcagcaacacagaaacg
ctgtgtagtgagcaaaagtactattgtgaaacatgctgcagcaaacaggaggctcagaag
aggatgagggtaaaaaagctgcccatgattttggccctgcacctaaagaggttcaagtac
atggagcagctccacaggtacaccaagctgtcttaccgggtggtcttccctctggagctc
cggctcttcaacacctccagcgatgctgtcaacctggaccgcatgtatgacctggttgct
gtcgtcgttcactgtggaagtggtcctaaccgtgggcattacatcaccatcgtgaaaagt
catggcttttggctattgtttgatgacgacatcgtagagaaaatagatgctcaagccatt
gaggaattctatggtctaacgtcagacatatcaaaaaattcagaatctggatatatttta
ttctatcaatcaagagaataa

DBGET integrated database retrieval system