KEGG   Rattus norvegicus (rat): 289759Help
Entry
289759            CDS       T01003                                 

Gene name
Myl7
Definition
(RefSeq) myosin light chain 7
  KO
K12754  
myosin regulatory light chain 7
Organism
rno  Rattus norvegicus (rat)
Pathway
Focal adhesion
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    289759 (Myl7)
  Cell motility
   04810 Regulation of actin cytoskeleton
    289759 (Myl7)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    289759 (Myl7)
Cytoskeleton proteins [BR:rno04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     289759 (Myl7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
14q21
AA seq 148 aa AA seqDB search
MFEQAQIQEFKEAFSCIDQNRDGIICKSDLKETYSQLGRVSVPEEELDAMLQEGKGPINF
TVFLTLFGEKLNGTDPEEAILSAFRMFDPSGQGVVNKEEFKQLLMTQADKFSPAEVEQLF
ALTPMDLTGNIDYKSLCYIITHGDEKEE
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagcaagcccagattcaggaattcaaggaagccttcagctgcattgaccagaac
agagacggaatcatctgcaagtcagacctgaaggagacttattcccagctcgggagggta
agtgtcccagaggaggagctggatgccatgctgcaagaggggaagggccccatcaacttc
accgtcttcctcacgctcttcggggagaaactcaatgggaccgaccctgaggaggccatc
ctgagtgctttccgaatgtttgacccgagcggccagggagttgtgaacaaggaggagttc
aagcagcttctcatgacccaggcagacaagttctctcctgctgaggtggagcagctgttc
gccctgacacccatggacctgacaggcaacatcgactacaagtctctctgctacatcatc
acccacggggatgagaaagaggagtag

DBGET integrated database retrieval system