KEGG   Rattus norvegicus (rat): 289759Help
Entry
289759            CDS       T01003                                 

Gene name
Myl7
Definition
myosin, light chain 7, regulatory
Orthology
K12754  
myosin regulatory light chain 7
Organism
rno  Rattus norvegicus (rat)
Pathway
Focal adhesion
Tight junction
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:rno00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    289759 (Myl7)
  Cellular commiunity
   04510 Focal adhesion
    289759 (Myl7)
   04530 Tight junction
    289759 (Myl7)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    289759 (Myl7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
UniProt: 
Position
14q21
AA seq 148 aa AA seqDB search
MFEQAQIQEFKEAFSCIDQNRDGIICKSDLKETYSQLGRVSVPEEELDAMLQEGKGPINF
TVFLTLFGEKLNGTDPEEAILSAFRMFDPSGQGVVNKEEFKQLLMTQADKFSPAEVEQLF
ALTPMDLTGNIDYKSLCYIITHGDEKEE
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgttcgagcaagcccagattcaggaattcaaggaagccttcagctgcattgaccagaac
agagacggaatcatctgcaagtcagacctgaaggagacttattcccagctcgggagggta
agtgtcccagaggaggagctggatgccatgctgcaagaggggaagggccccatcaacttc
accgtcttcctcacgctcttcggggagaaactcaatgggaccgaccctgaggaggccatc
ctgagtgctttccgaatgtttgacccgagcggccagggagttgtgaacaaggaggagttc
aagcagcttctcatgacccaggcagacaagttctctcctgctgaggtggagcagctgttc
gccctgacacccatggacctgacaggcaacatcgactacaagtctctctgctacatcatc
acccacggggatgagaaagaggagtag

DBGET integrated database retrieval system