KEGG   Rattus norvegicus (rat): 290326Help
Entry
290326            CDS       T01003                                 

Gene name
Pbk
Definition
PDZ binding kinase (EC:2.7.11.1)
Orthology
K08865  
PDZ-binding kinase [EC:2.7.12.2]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     290326 (Pbk)
Protein kinases [BR:rno01001]
 Serine/threonine protein kinases: Other group
  TOPK family
   290326 (Pbk)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
15p12
AA seq 337 aa AA seqDB search
MEGISNFKTPNKLSEKRKSVLCSTPCVNIPASPFMQKLGFGTGVSVYLMKRSPRGLSHSP
WAVKKINPLCDDHYRTVYQKRLTDEAKILKNLNHPNIVGYRAFTEASDGSLCLAMEYGGE
KSLNDLIEERNKDSGSPFPAAVILRVALHMARGLKYLHQEKKLLHGDIKSSNVVIKGDFE
TIKICDVGVSLPLDENMTVTDPEACYIGTEPWKPKEALEENGIITDKADMFAFGLTLWEM
MTLCIPHINLPDDDDDEDATFDESDFDDEAYYAALGTRPSINMEELDESYQKVIELFCVC
TNEDPKDRPSAAHIVEALELDGQCCGLSSKHSLYGNC
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atggaaggaatcagtaatttcaagacgccaaacaaattatctgaaaaaaggaaatctgta
ttatgttcaactccatgtgtaaatatccctgcctctccatttatgcagaagctcggcttt
gggactggggtcagtgtttacctaatgaaaagatctccgagagggttgtcccattctcct
tgggctgtgaaaaagataaatcctttatgcgatgatcattatcgaactgtgtatcagaag
agactaactgatgaagctaagattttaaaaaaccttaatcacccaaacattgtaggctat
cgtgcttttactgaagccagtgatggtagtctgtgccttgctatggagtatggaggtgaa
aagtctctgaatgacttaatagaagagcggaacaaagacagtggaagtccttttccagca
gctgtaattctcagagttgctttgcacatggcaagagggctaaagtatctgcatcaggaa
aagaagctgctgcatggagacataaagtcttcaaatgttgtaattaaaggtgactttgaa
acaattaaaatctgtgatgtaggagtctctctgccattggatgaaaatatgactgtgact
gatcctgaggcctgttatattggtactgagccatggaaacccaaagaagcattggaggaa
aatggcattattactgacaaggcagatatgtttgcttttggccttactctttgggaaatg
atgactttatgtattccacacatcaaccttccagatgatgatgatgatgaagatgcaaca
tttgatgagagtgacttcgatgatgaagcttactatgcagctctggggacaagaccatcc
atcaatatggaagaactggatgaatcctaccagaaggtcattgaactcttctgtgtgtgt
actaatgaggatcctaaagatcgcccatctgctgcacacatcgttgaagctttggaacta
gatggccaatgttgtggtctaagctcgaagcatagcttgtatgggaactgttaa

DBGET integrated database retrieval system