KEGG   Rattus norvegicus (rat): 290864Help
Entry
290864            CDS       T01003                                 

Gene name
Usp4
Definition
(RefSeq) ubiquitin specific peptidase 4 (EC:3.4.19.12)
  KO
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.4.19.12]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     290864 (Usp4)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   290864 (Usp4)
Ubiquitin system [BR:rno04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    290864 (Usp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
8
AA seq 961 aa AA seqDB search
MAEGRGTHERPDVETQKTELGALMGTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVG
EHNLFPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPIVRK
VVEHGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERE
TRLWNKYMSNTYEQLSKLDNTIQDAGLYQGQVLVIEPQNEDGTWPRQTLQSKSSTAPSRN
FTTSSKPSASPYSSMSASLIANGDSTNSSGMHNSGVSRGGAGFSASYNCQEPPSPHIQPG
LCGLGNLGNTCFMNSALQCLSNTGPLTEYFLKDEYEAEINRDNPLGMKGEIAEAYAELIK
QMWSGRDTHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFILDGLHEDLNRVKKKPYLEP
KDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKVSVTFDPFCYLTLP
LPLKKDRIMEVFLVPADPHCRPIQYRVTVPLMGAISDLCEALSKLSGIAAENMVVTDVYN
HRFHKIFQMDEGLSHITPRDDIFVYEICTTPMDGSEYITLPVYFREKKSRPSSTSSGAVL
YGQPLLVSVPKHRLTLESLYQAVCERISRYIKQPLPEEFLSSPLEPGACNGSRGSYEGDE
EEMDHQEEGKEQLSEVEESGEDSQGGDPTETTQKAKGPPRHKRLFTFSLVNSCGTADINS
LATDGKLLKLNSRSTLAIDWDSETRSLYFDEQESEACEKHTSMSQPQKKKKAAIALRECI
ELFTTMETLGEHDPWYCPTCKKHQQATKKFDLWSLPKILVVHLKRFSYNRYWRDKLDTVV
EFPVRALNMSEFVCDRAARPYVYDLIAVSNHYGAMGVGHYTAYAKNRLNGKWYYFDDSSV
SLASEDQIVTKAAYVLFYQRRDDECPSTSSPVSFPGSDGGAKLSSSQQDLGEEEAYTMDT
N
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggccggggcacccatgagcgaccggatgtggagacccagaagacggagctc
ggagccttgatggggaccacgctccagcgtggggctcagtggtatctgatcgacagccgg
tggttcaagcagtggaagaagtacgtcggctttgacagctgggacatgtacaacgtgggg
gagcacaatctctttcctggaccgattgacaactctgggctcttctcagatcctgagagt
cagaccttgaaggaacacttaatcgatgagctggactatgtgttggttccaactgaagcc
tggaataaattgctaaattggtatggctgtgtggaaggccagcagcctattgtcagaaaa
gttgtggagcatggcctgtttgtcaagcactgcaaagtggaagtgtatttgctggagttg
aagctctgtgagaacagtgaccccaccaatgtgctaagttgccattttagcaaagcagat
accattgcaactattgagaaggagatgaggaagctcttcaacatccctgcagagcgtgaa
acacgactttggaacaaatacatgagcaacacctatgagcagttgagcaagctagacaac
actatccaggatgctgggctgtaccagggtcaggtgctagtaattgagccccaaaatgaa
gacggcacatggcccaggcagaccctgcaatcaaaatcaagcactgcacctagcagaaat
tttactacctcttcaaaaccatccgcaagtccctattcctcaatgtctgcctctctcatt
gcaaatggtgatagcactaacagctctgggatgcacaactccggtgtcagcaggggtgga
gctggcttctctgcctcgtataattgccaggagcccccatcacctcatatccagcctggc
ctctgtggactcggaaacctgggaaacacctgttttatgaattctgctttgcagtgcctg
agcaacactggtccactgactgagtactttctcaaagatgagtatgaggccgagatcaac
agagacaaccctctggggatgaaaggggagattgcagaggcctatgcagagctcatcaag
cagatgtggtctggaagggacacccacgtagcaccacggatgttcaaaacgcaagtggga
cgtttcgcccctcagttttctggctaccaacaacaagactctcaagagctgttagccttt
attctagatggattgcatgaagacctgaaccgagtaaagaagaagccttacctggagcca
aaggatgccaatgggcgaccagatgcggtggtagcaaaggaagcctgggaaaatcacagg
ctgaggaatgactctgtgattgtggatactttccatggccttttcaaatctactttggtt
tgcccagaatgtgctaaagtttctgtgacctttgacccattttgctatctaactctccca
ctgcctttgaagaaagatcgaattatggaggtcttcctggttcctgctgaccctcattgc
agacctatccagtaccgtgtgactgtgccattgatgggggccatttctgacctgtgtgaa
gcactctccaagctgtctggcattgctgcagaaaatatggtggtcactgatgtgtataat
caccgcttccacaaaattttccaaatggatgaaggtttaagccacatcacgcctcgagat
gacatttttgtgtatgagatctgcaccactcccatggatggctcagaatatatcactctc
ccagtctacttcagagaaaagaagtccaggccatcgagtacttcctctggggccgtgctc
tatggacagccacttcttgtttctgtccctaagcacagactaaccctcgagtccttatac
caggctgtttgtgaacgtatcagccgctatataaagcagcctttgcctgaggagtttctc
agctctcccttagagcctggggcctgcaatggctctaggggtagctatgaaggagatgaa
gaagaaatggatcatcaagaggaagggaaagaacagctttctgaagtggaagaaagtggt
gaggacagtcagggaggggaccctactgagaccacccaaaaggcgaaaggcccgccccgc
cacaagaggcttttcaccttcagcctcgtgaactcctgtggaactgctgatatcaactcg
ctggccactgacggaaaactcctcaagctcaactctcgatccacactggccattgactgg
gacagtgagacccgaagcctttactttgatgagcaagaatctgaggcctgtgagaagcac
acgagcatgtcccagcctcagaagaagaagaaggctgcaatagccctgcgggagtgcatc
gagctctttactaccatggagacccttggggagcatgacccctggtactgtcccacctgt
aagaagcaccaacaggcaacaaaaaagtttgatttgtggtctttgcccaagatcctggtg
gttcatctcaaacgtttctcctataacagatactggcgggataaactggacacagttgtg
gaattcccagtaagagctctgaacatgtccgagtttgtgtgtgaccgggcagcaaggcct
tatgtctatgacctgattgctgtgtccaatcactatggcgctatgggggtcggtcactat
actgcatatgcgaagaacagactgaatgggaaatggtattactttgatgatagcagcgtg
tccctggcctctgaggatcagatagtgacgaaggccgcctacgtgttgttttaccagcgt
cgggatgatgagtgtcccagcacctcctcacctgtcagcttcccgggttctgatggaggg
gcgaagctcagcagctcacagcaggacttgggggaagaggaggcttacaccatggacacc
aactga

DBGET integrated database retrieval system