KEGG   Rattus norvegicus (rat): 290864Help
Entry
290864            CDS       T01003                                 

Gene name
Usp4
Definition
ubiquitin specific peptidase 4 (proto-oncogene) (EC:3.4.19.12)
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     290864 (Usp4)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   290864 (Usp4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
8
AA seq 914 aa AA seqDB search
MAEGRGTHERPDVETQKTELGALMGTTLQRGAQWYLIDSRWFKQWKKYVGFDSWDMYNVG
EHNLFPGPIDNSGLFSDPESQTLKEHLIDELDYVLVPTEAWNKLLNWYGCVEGQQPIVRK
VVEHGLFVKHCKVEVYLLELKLCENSDPTNVLSCHFSKADTIATIEKEMRKLFNIPAERE
TRLWNKYMSNTYEQLSKLDNTIQDAGLYQGQVLVIEPQNEDGTWPRQTLQSNGAGFSASY
NCQEPPSPHIQPGLCGLGNLGNTCFMNSALQCLSNTGPLTEYFLKDEYEAEINRDNPLGM
KGEIAEAYAELIKQMWSGRDTHVAPRMFKTQVGRFAPQFSGYQQQDSQELLAFILDGLHE
DLNRVKKKPYLEPKDANGRPDAVVAKEAWENHRLRNDSVIVDTFHGLFKSTLVCPECAKV
SVTFDPFCYLTLPLPLKKDRIMEVFLVPADPHCRPIQYRVTVPLMGAISDLCEALSKLSG
IAAENMVVTDVYNHRFHKIFQMDEGLSHITPRDDIFVYEICTTPMDGSEYITLPVYFREK
KSRPSSTSSGAVLYGQPLLVSVPKHRLTLESLYQAVCERISRYIKQPLPEEFLSSPLEPG
ACNGSRGSYEGDEEEMDHQEEGKEQLSEVEESGEDSQGGDPTETTQKAKGPPRHKRLFTF
SLVNSCGTADINSLATDGKLLKLNSRSTLAIDWDSETRSLYFDEQESEACEKHTSMSQPQ
KKKKAAIALRECIELFTTMETLGEHDPWYCPTCKKHQQATKKFDLWSLPKILVVHLKRFS
YNRYWRDKLDTVVEFPVRALNMSEFVCDRAARPYVYDLIAVSNHYGAMGVGHYTAYAKNR
LNGKWYYFDDSSVSLASEDQIVTKAAYVLFYQRRDDECPSTSSPVSFPGSDGGAKLSSSQ
QDLGEEEAYTMDTN
NT seq 2745 nt NT seq  +upstreamnt  +downstreamnt
atggcggaaggccggggcacccatgagcgaccggatgtggagacccagaagacggagctc
ggagccttgatggggaccacgctccagcgtggggctcagtggtatctgatcgacagccgg
tggttcaagcagtggaagaagtacgtcggctttgacagctgggacatgtacaacgtgggg
gagcacaatctctttcctggaccgattgacaactctgggctcttctcagatcctgagagt
cagaccttgaaggaacacttaatcgatgagctggactatgtgttggttccaactgaagcc
tggaataaattgctaaattggtatggctgtgtggaaggccagcagcctattgtcagaaaa
gttgtggagcatggcctgtttgtcaagcactgcaaagtggaagtgtatttgctggagttg
aagctctgtgagaacagtgaccccaccaatgtgctaagttgccattttagcaaagcagat
accattgcaactattgagaaggagatgaggaagctcttcaacatccctgcagagcgtgaa
acacgactttggaacaaatacatgagcaacacctatgagcagttgagcaagctagacaac
actatccaggatgctgggctgtaccagggtcaggtgctagtaattgagccccaaaatgaa
gacggcacatggcccaggcagaccctgcaatcaaatggagctggcttctctgcctcgtat
aattgccaggagcccccatcacctcatatccagcctggcctctgtggactcggaaacctg
ggaaacacctgttttatgaattctgctttgcagtgcctgagcaacactggtccactgact
gagtactttctcaaagatgagtatgaggccgagatcaacagagacaaccctctggggatg
aaaggggagattgcagaggcctatgcagagctcatcaagcagatgtggtctggaagggac
acccacgtagcaccacggatgttcaaaacgcaagtgggacgtttcgcccctcagttttct
ggctaccaacaacaagactctcaagagctgttagcctttattctagatggattgcatgaa
gacctgaaccgagtaaagaagaagccttacctggagccaaaggatgccaatgggcgacca
gatgcggtggtagcaaaggaagcctgggaaaatcacaggctgaggaatgactctgtgatt
gtggatactttccatggccttttcaaatctactttggtttgcccagaatgtgctaaagtt
tctgtgacctttgacccattttgctatctaactctcccactgcctttgaagaaagatcga
attatggaggtcttcctggttcctgctgaccctcattgcagacctatccagtaccgtgtg
actgtgccattgatgggggccatttctgacctgtgtgaagcactctccaagctgtctggc
attgctgcagaaaatatggtggtcactgatgtgtataatcaccgcttccacaaaattttc
caaatggatgaaggtttaagccacatcacgcctcgagatgacatttttgtgtatgagatc
tgcaccactcccatggatggctcagaatatatcactctcccagtctacttcagagaaaag
aagtccaggccatcgagtacttcctctggggccgtgctctatggacagccacttcttgtt
tctgtccctaagcacagactaaccctcgagtccttataccaggctgtttgtgaacgtatc
agccgctatataaagcagcctttgcctgaggagtttctcagctctcccttagagcctggg
gcctgcaatggctctaggggtagctatgaaggagatgaagaagaaatggatcatcaagag
gaagggaaagaacagctttctgaagtggaagaaagtggtgaggacagtcagggaggggac
cctactgagaccacccaaaaggcgaaaggcccgccccgccacaagaggcttttcaccttc
agcctcgtgaactcctgtggaactgctgatatcaactcgctggccactgacggaaaactc
ctcaagctcaactctcgatccacactggccattgactgggacagtgagacccgaagcctt
tactttgatgagcaagaatctgaggcctgtgagaagcacacgagcatgtcccagcctcag
aagaagaagaaggctgcaatagccctgcgggagtgcatcgagctctttactaccatggag
acccttggggagcatgacccctggtactgtcccacctgtaagaagcaccaacaggcaaca
aaaaagtttgatttgtggtctttgcccaagatcctggtggttcatctcaaacgtttctcc
tataacagatactggcgggataaactggacacagttgtggaattcccagtaagagctctg
aacatgtccgagtttgtgtgtgaccgggcagcaaggccttatgtctatgacctgattgct
gtgtccaatcactatggcgctatgggggtcggtcactatactgcatatgcgaagaacaga
ctgaatgggaaatggtattactttgatgatagcagcgtgtccctggcctctgaggatcag
atagtgacgaaggccgcctacgtgttgttttaccagcgtcgggatgatgagtgtcccagc
acctcctcacctgtcagcttcccgggttctgatggaggggcgaagctcagcagctcacag
caggacttgggggaagaggaggcttacaccatggacaccaactga

DBGET integrated database retrieval system