KEGG   Rattus norvegicus (rat): 291157Help
Entry
291157            CDS       T01003                                 

Gene name
Hist1h2bo, Hist1h2bm, Hist1h2bn
Definition
histone cluster 1, H2bo
Orthology
K11252  
histone H2B
Organism
rno  Rattus norvegicus (rat)
Pathway
Alcoholism
Viral carcinogenesis
Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:rno00001]
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    291157 (Hist1h2bo)
  Immune diseases
   05322 Systemic lupus erythematosus
    291157 (Hist1h2bo)
  Substance dependence
   05034 Alcoholism
    291157 (Hist1h2bo)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   291157 (Hist1h2bo)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
17q11
AA seq 138 aa AA seqDB search
MPDPVKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM
GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT
KYTSSKILWNKFYYLPSF
NT seq 417 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatccggttaagtccgcccccgccccgaagaagggctccaagaaggccgtgacc
aaggcgcagaagaaggacggcaagaagcgcaagcgcagccgcaaagagagctactcggtg
tacgtgtacaaggtactgaagcaagtgcacccggacaccggcatctcttccaaggccatg
ggcataatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcgcgc
ctggcgcattacaacaagcgctcgaccatcacgtcccgggagatccagacggccgtgcgc
ctgctgctgcccggggagctggccaagcacgctgtgtccgagggcaccaaggcggtcacc
aagtacaccagctccaaaatcctgtggaacaaattctattatcttccttccttttaa

DBGET integrated database retrieval system