KEGG   Rattus norvegicus (rat): 29153Help
Entry
29153             CDS       T01003                                 

Gene name
Capn1
Definition
calpain 1, (mu/I) large subunit (EC:3.4.22.52)
Orthology
K01367  
calpain-1 [EC:3.4.22.52]
Organism
rno  Rattus norvegicus (rat)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Alzheimer's disease
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:rno04141]
Cellular Processes; Cell growth and death; Apoptosis [PATH:rno04210]
Human Diseases; Neurodegenerative diseases; Alzheimer's disease [PATH:rno05010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q43
AA seq 713 aa AA seqDB search
MAEELITPVYCTGVSAQVQKQRDKELGLGRHENAIKYLGQDYENLRARCLQNGVLFQDDA
FPPVSHSLGFKELGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNETILHRVVPYGQSFQEGYAGIFHFQLWQFGEWVDVVVDDLLPTKDGKLVFVHS
AQGNEFWSALLEKAYAKVNGSYEALSGGCTSEAFEDFTGGVTEWYDLQKAPSDLYQIILK
ALERGSLLGCSINISDIRDLEAITFKNLVRGHAYSVTDAKQVTYQGQRVNLIRMRNPWGE
VEWKGPWSDNSYEWNKVDPYEREQLRVKMEDGEFWMSFRDFIREFTKLEICNLTPDALKS
RTLRNWNTTFYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLEEVDDADDYDSRESGCSFL
LALMQKHRRRERRFGRDMETIGFAVYQVPRELAGQPVHLKRDFFLANASRAQSEHFINLR
EVSNRIRLPPGEYIVVPSTFEPNKEGDFLLRFFSEKKAGTQELDDQIQANLPDEKVLSEE
EIDDNFKTLFSKLAGDDMEISVKELQTILNRIISKHKDLRTNGFSLESCRSMVNLMDRDG
NGKLGLVEFNILWNRIRNYLTIFRKFDLDKSGSMSAYEMRMAIEAAGFKLNKKLHELIIT
RYSEPDLAVDFDNFVCCLVRLETMFRFFKILDTDLDGVVTFDLFKWLQLTMFA
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggagttaatcacacctgtgtactgcaccggggtgtcagcccaagtgcagaag
caacgggacaaggagttgggcttgggccgccatgaaaatgccatcaagtacctgggccag
gattatgaaaatcttcgtgcaagatgcctgcagaacggggtcctcttccaagacgatgcc
ttccctccagtttctcatagcttgggcttcaaggaactgggtcccaattcctctaaaacc
tatggcatcaagtggaagcgtcctacggaactgctgtcaaacccccagttcatcgtggat
ggagccacccgaacggacatctgccagggagcactgggggactgttggctcctggctgcc
attgcctcgctcactctcaacgagactatcctccaccgagtggttccctacggccagagc
ttccaggagggctatgctggcatctttcatttccagctgtggcagtttggggagtgggta
gatgtggttgtggatgatttgctacccaccaaggatggaaagctggtgttcgtgcactct
gcccagggcaacgagttctggagcgctctcctggagaaagcctatgcaaaagtgaatggc
agctatgaggccctttcgggaggctgcacctcagaggccttcgaggactttaccggtggg
gtcactgagtggtacgatctgcagaaggcacccagcgacctctaccagatcattctgaag
gccctggaacgaggctccttgctgggctgctccattaatatctccgatatccgtgatttg
gaggctattacttttaagaacctggtgaggggccatgcatactctgtgacggatgccaag
caggtcacttaccagggccagcgggtgaacctaatccggatgcggaacccctggggtgaa
gtggagtggaaaggaccctggagtgacaactcctatgagtggaacaaagtggacccctat
gaacgtgagcagctgagggtcaagatggaggacggggagttctggatgtccttccgggac
ttcatacgtgagttcaccaaactggaaatctgcaaccttacacctgacgcccttaagagc
agaaccctccggaactggaataccacattttacgagggcacctggcgccggggaagcact
gctggaggctgcaggaactacccagctaccttctgggtaaacccccagttcaagatccgg
ctggaggaggtggatgacgcagacgactatgacagtcgagagtccggctgcagcttcttg
ttggccctcatgcagaagcatcgccgcagggagcgtcgctttggccgggacatggagacc
attggttttgcagtgtaccaggtccctcgggagttggcgggtcagcctgtgcacttgaag
cgtgacttcttcctggccaatgcttctcgggcacaatcagagcactttatcaaccttcga
gaggtcagtaaccgcatccgcctgccgccgggggagtatatagtggtgccctccaccttc
gagcccaacaaagagggtgactttctgctgcgcttcttttcagagaagaaggctgggacc
caggaactagatgaccagatccaggccaacctccccgatgagaaagtgctctctgaagag
gagatcgatgacaacttcaaaaccctgttcagcaagttggcaggggatgacatggagatc
agtgtcaaggagttacagaccatcttgaacagaatcattagcaaacacaaagacctgcgc
actaacggcttcagcctggagtcgtgccgcagcatggtgaacctcatggatcgagacggt
aatgggaaactgggcctggtggagttcaacatcctgtggaaccgcatccgaaattacctg
accatcttccgaaagtttgacctggacaagtctggcagcatgagtgcttatgagatgagg
atggccatcgaggctgcaggcttcaagcttaacaagaagctgcatgagctcatcatcacc
cgctactcagagcccgacctggccgtggactttgacaactttgtgtgctgccttgtgcgc
ctggagaccatgttccggtttttcaaaattctggacacagacctggatggtgttgtgacc
tttgatctatttaagtggttacagctgactatgtttgcatga

DBGET integrated database retrieval system