KEGG   Rattus norvegicus (rat): 29153Help
Entry
29153             CDS       T01003                                 

Gene name
Capn1
Definition
calpain 1, (mu/I) large subunit (EC:3.4.22.52)
Orthology
K01367  
calpain-1 [EC:3.4.22.52]
Organism
rno  Rattus norvegicus (rat)
Pathway
Protein processing in endoplasmic reticulum
Apoptosis
Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:rno00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    29153 (Capn1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    29153 (Capn1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    29153 (Capn1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     29153 (Capn1)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C2: calpain family
   29153 (Capn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
1q43
AA seq 713 aa AA seqDB search
MAEELITPVYCTGVSAQVQKQRDKELGLGRHENAIKYLGQDYENLRARCLQNGVLFQDDA
FPPVSHSLGFKELGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNETILHRVVPYGQSFQEGYAGIFHFQLWQFGEWVDVVVDDLLPTKDGKLVFVHS
AQGNEFWSALLEKAYAKVNGSYEALSGGCTSEAFEDFTGGVTEWYDLQKAPSDLYQIILK
ALERGSLLGCSINISDIRDLEAITFKNLVRGHAYSVTDAKQVTYQGQRVNLIRMRNPWGE
VEWKGPWSDNSYEWNKVDPYEREQLRVKMEDGEFWMSFRDFIREFTKLEICNLTPDALKS
RTLRNWNTTFYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLEEVDDADDYDSRESGCSFL
LALMQKHRRRERRFGRDMETIGFAVYQVPRELAGQPVHLKRDFFLANASRAQSEHFINLR
EVSNRIRLPPGEYIVVPSTFEPNKEGDFLLRFFSEKKAGTQELDDQIQANLPDEKVLSEE
EIDDNFKTLFSKLAGDDMEISVKELQTILNRIISKHKDLRTNGFSLESCRSMVNLMDRDG
NGKLGLVEFNILWNRIRNYLTIFRKFDLDKSGSMSAYEMRMAIEAAGFKLNKKLHELIIT
RYSEPDLAVDFDNFVCCLVRLETMFRFFKILDTDLDGVVTFDLFKWLQLTMFA
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggcagaggagttaatcacacctgtgtactgcaccggggtgtcagcccaagtgcagaag
caacgggacaaggagttgggcttgggccgccatgaaaatgccatcaagtacctgggccag
gattatgaaaatcttcgtgcaagatgcctgcagaacggggtcctcttccaagacgatgcc
ttccctccagtttctcatagcttgggcttcaaggaactgggtcccaattcctctaaaacc
tatggcatcaagtggaagcgtcctacggaactgctgtcaaacccccagttcatcgtggat
ggagccacccgaacggacatctgccagggagcactgggggactgttggctcctggctgcc
attgcctcgctcactctcaacgagactatcctccaccgagtggttccctacggccagagc
ttccaggagggctatgctggcatctttcatttccagctgtggcagtttggggagtgggta
gatgtggttgtggatgatttgctacccaccaaggatggaaagctggtgttcgtgcactct
gcccagggcaacgagttctggagcgctctcctggagaaagcctatgcaaaagtgaatggc
agctatgaggccctttcgggaggctgcacctcagaggccttcgaggactttaccggtggg
gtcactgagtggtacgatctgcagaaggcacccagcgacctctaccagatcattctgaag
gccctggaacgaggctccttgctgggctgctccattaatatctccgatatccgtgatttg
gaggctattacttttaagaacctggtgaggggccatgcatactctgtgacggatgccaag
caggtcacttaccagggccagcgggtgaacctaatccggatgcggaacccctggggtgaa
gtggagtggaaaggaccctggagtgacaactcctatgagtggaacaaagtggacccctat
gaacgtgagcagctgagggtcaagatggaggacggggagttctggatgtccttccgggac
ttcatacgtgagttcaccaaactggaaatctgcaaccttacacctgacgcccttaagagc
agaaccctccggaactggaataccacattttacgagggcacctggcgccggggaagcact
gctggaggctgcaggaactacccagctaccttctgggtaaacccccagttcaagatccgg
ctggaggaggtggatgacgcagacgactatgacagtcgagagtccggctgcagcttcttg
ttggccctcatgcagaagcatcgccgcagggagcgtcgctttggccgggacatggagacc
attggttttgcagtgtaccaggtccctcgggagttggcgggtcagcctgtgcacttgaag
cgtgacttcttcctggccaatgcttctcgggcacaatcagagcactttatcaaccttcga
gaggtcagtaaccgcatccgcctgccgccgggggagtatatagtggtgccctccaccttc
gagcccaacaaagagggtgactttctgctgcgcttcttttcagagaagaaggctgggacc
caggaactagatgaccagatccaggccaacctccccgatgagaaagtgctctctgaagag
gagatcgatgacaacttcaaaaccctgttcagcaagttggcaggggatgacatggagatc
agtgtcaaggagttacagaccatcttgaacagaatcattagcaaacacaaagacctgcgc
actaacggcttcagcctggagtcgtgccgcagcatggtgaacctcatggatcgagacggt
aatgggaaactgggcctggtggagttcaacatcctgtggaaccgcatccgaaattacctg
accatcttccgaaagtttgacctggacaagtctggcagcatgagtgcttatgagatgagg
atggccatcgaggctgcaggcttcaagcttaacaagaagctgcatgagctcatcatcacc
cgctactcagagcccgacctggccgtggactttgacaactttgtgtgctgccttgtgcgc
ctggagaccatgttccggtttttcaaaattctggacacagacctggatggtgttgtgacc
tttgatctatttaagtggttacagctgactatgtttgcatga

DBGET integrated database retrieval system