KEGG   Rattus norvegicus (rat): 291796Help
Entry
291796            CDS       T01003                                 

Gene name
Usp14
Definition
ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase) (EC:3.4.19.12)
Orthology
K11843  
ubiquitin carboxyl-terminal hydrolase 14 [EC:3.1.2.15]
Organism
rno  Rattus norvegicus (rat)
Brite
Enzymes [BR:rno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     291796 (Usp14)
Peptidases [BR:rno01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   291796 (Usp14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
18p13
AA seq 493 aa AA seqDB search
MPLYSVTVKWGKEKFEGVELNTDEPPMVFKAQLFALTGVQPARQKVMVKGGTLKDDDWGN
IKMKNGMTVLMMGSADALPEEPSAKTVFVEDMTEEQLATAMELPCGLTNLGNTCYMNATV
QCIRSVPELKDALKRYAGALRASGEMASAQYITAALRDLFDSMDKTSSSIPPIILLQFLH
MAFPQFAEKGEQGQYLQQDANECWIQMMRVLQQKLEAIEDDSARETESSSASAVTPSKKK
SLIDQFFGVEFETTMKCTESEEEEVTKGKENQLQLSCFINQEVKYLFTGLKLRLQEEITK
QSPTLQRNALYIKSSKISRLPAYLTIQMVRFFYKEKESVNAKVLKDVKFPLMLDVYELCT
PELQEKMISFRSKFKDLEDKKVNQQPNANDKNSPPKEIKYEPFSFADDIGSNNCGYYDLQ
AVLTHQGRSSSSGHYVSWVKRKEDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYG
PRRVEIMEEDSEQ
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgccactctactctgttacagtaaaatggggaaaggagaaatttgaaggtgtagaattg
aatactgatgaacctccaatggtgttcaaggcccagctttttgcattgactggagtccag
ccagccagacaaaaagttatggtgaaaggaggaaccctgaaggatgatgactggggaaac
atcaaaatgaaaaatggaatgactgtactaatgatggggtcagcagatgctcttccagaa
gaaccctctgctaaaactgtcttcgtagaagacatgacagaagaacagttagcaactgct
atggagttgccgtgtggattgacaaacctcggtaacacttgttacatgaacgctacagtt
cagtgtattcgctctgtgcctgaactcaaagacgcccttaaaaggtatgcaggtgccttg
agagcttcaggggaaatggcttcagcacagtatattactgcagctcttagagatttgttt
gattccatggataaaacttcttctagtatcccacctattattctgctgcagtttctgcac
atggcttttccacagtttgcagagaagggcgaacaagggcagtatcttcagcaggatgct
aacgagtgctggatacaaatgatgagagtcctgcaacagaaactagaagccatagaggat
gattctgctagagagaccgagtcttcatctgcatcagcagtcacaccttctaaaaagaaa
agcttaattgatcagttttttggtgttgagtttgaaactaccatgaaatgtacagaatct
gaagaagaagaggtcaccaaaggaaaggaaaatcaacttcaacttagttgtttcattaac
caggaagtgaagtatcttttcacagggcttaaattgcgacttcaggaagaaattactaaa
cagtctccaacattgcagagaaatgctttgtacatcaaatcttctaagatcagccggcta
cctgcttacttaactattcagatggttcgatttttttataaagagaaagaatctgtgaac
gccaaagttcttaaggatgttaaatttcctctcatgttggatgtgtatgaactctgtaca
ccggaacttcaagagaaaatgatctcttttcggtcaaaattcaaggatctagaagataaa
aaagtgaatcagcaaccaaatgcaaacgacaagaatagtcctccaaaagagattaagtat
gaacccttttcatttgctgatgatattggctccaataattgtggctactatgacttacaa
gcagtgttaactcaccagggaagatctagttcttcgggtcattatgtatcatgggtgaaa
agaaaagaagatgaatggatcaaatttgatgacgataaggtcagcattgtaacaccagaa
gatattctgcgactgtctggaggtggagactggcacattgcttatgttctactttatggg
cctcgaagggttgaaataatggaagaagacagtgaacagtaa

DBGET integrated database retrieval system