KEGG   Rattus norvegicus (rat): 29194Help
Entry
29194             CDS       T01003                                 

Gene name
Chka, CK-R, Chk
Definition
choline kinase alpha (EC:2.7.1.32 2.7.1.82)
Orthology
K14156  
choline/ethanolamine kinase [EC:2.7.1.32 2.7.1.82]
Organism
rno  Rattus norvegicus (rat)
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Phosphatidylethanolamine (PE) biosynthesis, ethanolamine => PE
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    29194 (Chka)
Enzymes [BR:rno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     29194 (Chka)
    2.7.1.82  ethanolamine kinase
     29194 (Chka)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
1q42
AA seq 435 aa AA seqDB search
MKTKFCTGGEAEPSPLGLLLSCGGSAAPTPGVGQQRDAAGELESKQLGGRSQPLALPPPP
PPPLPLPPPPSPPLADEQPEPRTRRRAYLWCKEFLPGAWRGLREDQFHISVIRGGLSNML
FQCSLPDSIASVGDEPRKVLLRLYGAILKMGAEAMVLESVMFAILAERSLGPKLYGIFPQ
GRLEQFIPSRRLDTEELCLPDISAEIAEKMATFHGMKMPFNKEPKWLFGTMEKYLNQVLR
LKFSREARVQQLHKFLSYNLPLELENLRSLLQYTRSPVVFCHNDCQEGNILLLEGQENSE
KQKLMLIDFEYSSYNYRGFDIGNHFCEWMYDYTYEKYPFFRANIQKYPTRKQQLHFISSY
LTTFQNDFESLSSEEQSATKEDMLLEVNRFALASHFLWGLWSIVQAKISSIEFGYMEYAQ
ARFDAYFDQKRKLGV
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaagttctgcaccgggggcgaggccgagccgtccccgcttgggctgctgctg
agctgcggtggcagcgctgccccgacgcccggcgtagggcagcagcgcgatgccgcaggc
gagctggagtccaagcagcttggtggccggtcccaacctctcgcgctgccgccgccacca
ccgccgcccctgccgctgcccccgccgccatcaccgccgctagcggacgaacaacccgag
ccccggacgcggcgcagggcctacctgtggtgcaaggaattcctgcccggagcctggagg
ggccttcgcgaggaccagttccacatcagtgtcatcaggggtggtctcagtaacatgctg
ttccagtgttccttgccagactccatagccagtgttggtgatgaacctcggaaagtgctc
ttgcgactgtatggggcaatcttaaagatgggggctgaagcaatggttctggagagtgtt
atgtttgccattcttgcagagaggtcacttgggccaaaactctatggcatctttccgcaa
ggccgactggagcagtttatcccgagccggcgattggacactgaagaattatgtttacca
gatatttctgcagaaatagctgaaaaaatggccacatttcatggtatgaaaatgccattc
aataaggaaccaaaatggctttttggaacaatggaaaaatacctgaatcaagtactaaga
cttaaattcagcagggaggccagagttcaacaactgcacaagttcctctcttacaatctg
cctctcgagcttgagaacctgaggtcattgctgcagtatactagatccccagttgtgttt
tgtcataatgactgtcaagaaggtaatatcttattgttggaaggccaagagaattctgaa
aagcagaagttgatgctcattgactttgaatacagcagttacaattacaggggatttgac
attggaaatcatttctgtgaatggatgtatgattatacctatgaaaagtatcctttcttc
agagcaaacattcagaagtatcctacccgaaaacaacagctccattttatttcaagttac
ttgactacattccaaaatgattttgaaagcctcagcagtgaagagcagtctgctacaaaa
gaagacatgttgcttgaagtcaacagatttgcccttgcctctcatttcctctggggactt
tggtccattgtacaggccaagatctcatccattgaatttgggtacatggaatatgcccaa
gccaggttcgatgcctactttgaccagaagaggaagcttggtgtgtga

DBGET integrated database retrieval system