KEGG   Rattus norvegicus (rat): 29215Help
Entry
29215             CDS       T01003                                 

Gene name
Arg2
Definition
(RefSeq) arginase 2 (EC:3.5.3.1)
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of antibiotics
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    29215 (Arg2)
  Amino acid metabolism
   00220 Arginine biosynthesis
    29215 (Arg2)
   00330 Arginine and proline metabolism
    29215 (Arg2)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    29215 (Arg2)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     29215 (Arg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Position
6q24
AA seq 354 aa AA seqDB search
MFLRSSVSRLLHGQIPCALTRSVHSVAVVGAPFSRGQKKKGVEYGPAAIREAGLLKRLSM
LGCHIKDFGDLSFTNVPKDDPYNNLVVYPRSVGIANQELAEVVSRAVSGGYSCVTLGGDH
SLAIGTISGHARHHPDLCVIWVDAHADINTPLTTVSGNIHGQPLSFLIRELQDKVPQLPG
FSWIKPCLSPPNLVYIGLRDVEPAEHFILKSFDIQYFSMRDIDRLGIQKVMEQTFDRLIG
KRKRPIHLSFDIDAFDPKLAPATGTPVVGGLTYREGLYITEEIHSTGLLSALDLVEVNPH
LATSEEEAKATASLAVDVIASSFGQTREGGHIAYDHLPTPSSPHESEKEECVRI
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgttcctgaggagcagcgtctcccgtctcctccacgggcaaattccttgtgccctgacg
agatccgtccactctgtagctgtagtcggagcccctttctctcggggacagaaaaagaaa
ggagtggaatatggcccagccgccatccgagaagctggcttgctgaagaggctttctatg
ttgggatgccatataaaagactttggagacttgagttttactaacgttcccaaagatgat
ccctacaataatctggtcgtgtatcctcgctcagtgggcattgccaaccaggaactggct
gaggtggttagtagagctgtgtcaggtggctacagctgtgtcacactgggaggagaccac
agcctggcaatcggtaccattagtggccatgcccgacaccacccagatctctgtgtcatc
tgggttgatgctcatgctgacattaatacacccctcaccactgtatcaggaaatatccat
gggcagcctctttcctttctcatcagagaactacaagacaaggtaccacaactgccagga
ttttcctggatcaaaccttgcctctctcccccaaatcttgtatacattggcttacgagat
gtggagcctgccgaacactttattttaaagagttttgacatccagtatttctccatgaga
gatattgatcgacttggtatccagaaggtcatggaacagacatttgatcggctgattggc
aagaggaagaggccgatccacctgagctttgacatagatgcatttgaccctaagctggct
ccagccacaggaacccctgtggtaggggggctgacctacagagaaggactgtacattact
gaagaaatacatagcacagggttgctgtcggctctggatcttgttgaagtcaatcctcat
ttggccacttctgaggaagaggccaaggctacagccagcctagcagtggatgtgattgct
tcaagttttggtcagacaagagaaggcggacacattgcctatgaccaccttcctactcct
agttcaccacatgaatcagaaaaggaagaatgtgtgagaatttag

DBGET integrated database retrieval system