KEGG   Rattus norvegicus (rat): 29220Help
Entry
29220             CDS       T01003                                 

Gene name
Thbs4
Definition
thrombospondin 4
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
rno  Rattus norvegicus (rat)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:rno00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    29220 (Thbs4)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    29220 (Thbs4)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    29220 (Thbs4)
  Cellular commiunity
   04510 Focal adhesion
    29220 (Thbs4)
 Human Diseases
  Infectious diseases
   05144 Malaria
    29220 (Thbs4)
Exosome [BR:rno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   29220 (Thbs4)
  Exosomal proteins of colorectal cancer cells
   29220 (Thbs4)
  Exosomal proteins of bladder cancer cells
   29220 (Thbs4)
Heparan sulfate/heparin binding proteins [BR:rno00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  29220 (Thbs4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
Position
2q12
AA seq 961 aa AA seqDB search
MLAPRAAAFLLLHLVLQPWQRAGAQATPQVFDLLPSSSQRLNPAALQPVLTDPTLHELYV
ISTFKLQSKSSATIFGLYSSSDNSKYFEFTVMGRLNKAILRYLKDDGKIHLVVFNNLQLA
DGRRHRILLRLSNLQRGAGSVELYLDCVQVDSVNNLPRAFSGLTQNPQAIELRTFQRKPQ
DFLEELKLVVRGSLFQVASLQDCFLQQSEPLAATGTGDFNRQFLGQMTQLNQLLGEVKDL
LRQQVKETSFLRNTIAECQACGPLSFQSPTPNTLVPIAPPAPPTRPTRRCDSSPCFRGVR
CTDTRDGFQCGPCPDGYTGNGITCSDVDECKYHPCYPGVRCTNLAPGFRCDACPVGFTGP
MVQGVGINFAKTNKQVCTDVDECRNGACVLNSICINTLGSYRCGPCKPGYTGDQTRGCRT
ERSCRNPEQNPCSVHAQCIEERQGDVTCVCGVGWAGDGYVCGKDVDIDSYPDEELPCSAR
NCKKDNCKYVPNSGQEDADRDGIGDACDEDADGDGILNEQDNCVLTHNVDQRNTDKDIFG
DACDNCRGVLNNDQKDTDGDGKGDACDDDMDGDGIKNILDNCPRVPNRDQQDRDGDGVGD
ACDSCPDVSNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKDGIG
DECDDDDDNDGIPDLVPPGPDNCRLVPNPAQEDSNNDGVGDICEADFDQDKVIDRIDVCP
ENAEITLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFNGVD
FEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLKAVK
SKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVRFYE
GSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQIQTFDRLD
N
NT seq 2886 nt NT seq  +upstreamnt  +downstreamnt
atgctagccccacgcgcggccgccttcctcctactgcacctggtcctgcagccgtggcag
cgggcgggcgcccaggccacaccccaggtctttgaccttctgccatcctccagccagagg
ctgaacccggccgccctgcagccagtcctgacagaccccaccctgcacgagctctatgtc
atctccaccttcaagctgcagagtaagagctcagccaccatctttggcctctactcctcg
agtgacaacagcaaatactttgaattcactgtgatgggacgcctgaacaaagccatcctc
cgttacctaaaggatgatgggaagattcatctggtggttttcaacaacctgcagctggcg
gatgggaggcgccaccggattctcctgagactcagcaatttgcagagaggggccggctcc
gtagaactctacttggactgtgtccaggttgattcagtgaacaacctccccagagccttc
tctggtctcacccagaacccacaggccattgaattgagaacattccagaggaagccccag
gacttcttggaagagctgaagctggtggtgaggggctctctgttccaggtggccagccta
caagactgtttcctgcagcagagtgagccgctggctgccacaggcacaggagactttaat
cgacagtttttgggtcaaatgacacaattaaaccagctccttggagaggtgaaagatctt
ctgaggcagcaggtcaaggaaacatcatttttgcgaaacactattgctgagtgccaggct
tgtggccctctcagcttccagtccccaaccccaaacacgctggtgcccatagctcctcca
gcacccccaacccgaccaacacgtcgctgtgactccagcccttgtttccgaggtgtccga
tgcacggacaccagggacggcttccaatgtggaccctgcccagatggctacacggggaac
gggatcacctgttctgacgtggatgagtgtaaataccatccctgctaccctggtgtgcgc
tgcacaaatttggctccgggtttcagatgtgatgcctgtccagtaggcttcacggggccc
atggtgcagggcgtggggatcaactttgccaaaacaaacaagcaggtgtgcactgatgtt
gacgagtgtcggaacggagcgtgtgttctgaactccatctgcattaacactctgggctct
taccgctgtgggccttgcaagccagggtacactggtgaccagacgaggggatgcaggacc
gaaaggagctgccggaacccagagcagaacccgtgcagtgtgcatgcgcagtgcattgag
gaacggcaaggggatgtgacgtgtgtgtgcggtgttggttgggccggcgacggctatgtc
tgtggaaaggatgtggacatcgacagttaccccgatgaagaactgccgtgctcagccagg
aactgcaagaaggataactgcaagtatgtgccaaactccggccaagaagacgcagacaga
gatggcattggagacgcctgtgatgaggatgcggatggagacgggatcttgaatgagcag
gacaactgtgtcctgactcacaatgtggaccagaggaacactgataaagatatctttggg
gatgcctgtgacaactgccggggcgtcctgaataatgaccagaaggacactgacggggat
gggaaaggagacgcctgtgatgacgacatggatggagacggaataaaaaacattttggac
aactgtccccgagttcccaaccgcgaccaacaggatcgggatggcgatggtgtcggagac
gcctgtgacagctgtcctgatgtcagtaaccctaaccagtcggatgtggataacgatctg
gttggggactcctgtgacaccaaccaagacagtgatggggatggccaccaggacagcaca
gacaactgccccaccgtcattaacagcgcccagctggacaccgacaaggacgggattggc
gatgaatgcgatgacgatgacgataatgacggcatcccagacctggttccccctggccca
gacaactgcaggcttgttcccaacccagcccaggaagatagcaacaatgatggagtagga
gatatctgtgaagctgacttcgaccaggacaaggtcattgatcgcattgatgtgtgtcct
gagaatgcggagatcaccctgactgacttcagggcctatcagactgtggtcctggaccct
gaaggggatgcccagatcgaccccaactgggtggtcctgaaccagggcatggagattgtg
cagaccatgaacagtgaccctggcctagcagtcgggtacacggcatttaatggagttgac
tttgaagggaccttccacgtaaacacccagacagatgacgactatgccggctttattttt
ggttaccaagacagttccagcttctatgtggtcatgtggaaacagacagagcagacatac
tggcaggctacgccattccgtgcagtagcagaacctggtattcagctcaaggccgtgaag
tctaaaactggcccaggggaacatctccgaaactccctgtggcacacaggggacaccagc
gaccaggtcaggctgctgtggaaggactccaggaatgtgggctggaaggacaaggtgtcc
taccgctggttcctgcagcataggccccaggtgggctacatcagggtgcggttttatgaa
ggctcagagttggtggctgactccggggtcactatagacaccaccatgcgcggaggccga
ctgggcgtgttctgcttctctcaggaaaacatcatctggtccaacctcaagtaccgctgt
aacgacaccataccagaggacttccaggagttccagatccagacctttgaccgcctggat
aattaa

DBGET integrated database retrieval system