KEGG   Rattus norvegicus (rat): 29221Help
Entry
29221             CDS       T01003                                 

Gene name
Arg1
Definition
arginase 1 (EC:3.5.3.1)
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:rno01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:rno00330]
Human Diseases; Infectious diseases; Amoebiasis [PATH:rno05146]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p12
AA seq 323 aa AA seqDB search
MSSKPKPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPN
DSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCV
IWVDAHTDINTPLTTSSGNLHGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLR
DVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVF
TPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALT
LSCFGTKREGNHKPETDYLKPPK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagctccaagccaaagcccatagagattatcggagcgcctttctctaagggacagcct
cgaggaggggtagagaaaggtcccgcagcattaaggaaagctggcctggtggagaagctt
aaagaaacagagtacaatgtgagagaccacggggatctggcctttgtggatgtccccaat
gacagcccctttcaaattgtgaagaacccacggtctgtgggaaaagccaatgaacagctg
gctgctgtggtagcagagacccagaagaatggaacaatcagtgtggtgctgggtggagac
cacagtatggcaattggaagcatctctggccacgccagggtccaccctgacctatgcgtc
atttgggtggatgctcacactgacatcaacactccgctgacaaccagctctgggaatctg
cacgggcaaccggtggcctttctcctgaaggaactgaaaggaaagttcccagatgtacca
ggattctcctgggtgaccccctgcatatctgccaaggacatcgtgtacatcggcttgcga
gatgtggaccctggggaacactatataataaaaactctgggcattaagtatttctcaatg
actgaagtggacaagctgggaattggcaaagtgatggaagagaccttcagctacctgctg
ggaaggaagaaaaggcccattcacctgagttttgatgttgatggactggacccagtattc
accccggctacgggcacacccgttgtgggaggcctatcttacagagaaggtctctacatc
acagaagaaatttacaagacagggctactttcaggactagatatcatggaagtgaaccca
actcttgggaagacaccagaggaggtgactcgtactgtgaacacggcagtggcgttgacc
ttgtcttgttttggaacgaaacgggaaggtaatcataagccagagactgactaccttaaa
ccaccgaaataa

DBGET integrated database retrieval system