KEGG   Rattus norvegicus (rat): 29221Help
Entry
29221             CDS       T01003                                 

Gene name
Arg1
Definition
(RefSeq) arginase 1 (EC:3.5.3.1)
  KO
K01476  
arginase [EC:3.5.3.1]
Organism
rno  Rattus norvegicus (rat)
Pathway
Arginine biosynthesis
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Amoebiasis
Module
Urea cycle
Polyamine biosynthesis, arginine => ornithine => putrescine
Brite
KEGG Orthology (KO) [BR:rno00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    29221 (Arg1)
  Amino acid metabolism
   00220 Arginine biosynthesis
    29221 (Arg1)
   00330 Arginine and proline metabolism
    29221 (Arg1)
 Human Diseases
  Infectious diseases
   05146 Amoebiasis
    29221 (Arg1)
Enzymes [BR:rno01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     29221 (Arg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
RGD: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
1p12
AA seq 323 aa AA seqDB search
MSSKPKPIEIIGAPFSKGQPRGGVEKGPAALRKAGLVEKLKETEYNVRDHGDLAFVDVPN
DSPFQIVKNPRSVGKANEQLAAVVAETQKNGTISVVLGGDHSMAIGSISGHARVHPDLCV
IWVDAHTDINTPLTTSSGNLHGQPVAFLLKELKGKFPDVPGFSWVTPCISAKDIVYIGLR
DVDPGEHYIIKTLGIKYFSMTEVDKLGIGKVMEETFSYLLGRKKRPIHLSFDVDGLDPVF
TPATGTPVVGGLSYREGLYITEEIYKTGLLSGLDIMEVNPTLGKTPEEVTRTVNTAVALT
LSCFGTKREGNHKPETDYLKPPK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagctccaagccaaagcccatagagattatcggagcgcctttctctaagggacagcct
cgaggaggggtagagaaaggtcccgcagcattaaggaaagctggcctggtggagaagctt
aaagaaacagagtacaatgtgagagaccacggggatctggcctttgtggatgtccccaat
gacagcccctttcaaattgtgaagaacccacggtctgtgggaaaagccaatgaacagctg
gctgctgtggtagcagagacccagaagaatggaacaatcagtgtggtgctgggtggagac
cacagtatggcaattggaagcatctctggccacgccagggtccaccctgacctatgcgtc
atttgggtggatgctcacactgacatcaacactccgctgacaaccagctctgggaatctg
cacgggcaaccggtggcctttctcctgaaggaactgaaaggaaagttcccagatgtacca
ggattctcctgggtgaccccctgcatatctgccaaggacatcgtgtacatcggcttgcga
gatgtggaccctggggaacactatataataaaaactctgggcattaagtatttctcaatg
actgaagtggacaagctgggaattggcaaagtgatggaagagaccttcagctacctgctg
ggaaggaagaaaaggcccattcacctgagttttgatgttgatggactggacccagtattc
accccggctacgggcacacccgttgtgggaggcctatcttacagagaaggtctctacatc
acagaagaaatttacaagacagggctactttcaggactagatatcatggaagtgaaccca
actcttgggaagacaccagaggaggtgactcgtactgtgaacacggcagtggcgttgacc
ttgtcttgttttggaacgaaacgggaaggtaatcataagccagagactgactaccttaaa
ccaccgaaataa

DBGET integrated database retrieval system